KEGG   Muricauda ruestringensis: Murru_0946Help
Entry
Murru_0946        CDS       T01598                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Murru_0946
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Murru_0946
Exosome [BR:mrs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Murru_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030620..1032116
Genome map
AA seq 498 aa AA seqDB search
MNQYILALDQGTTSSRAVVFDKKGTIISVAQKEFTQIFPKPGWVEHDPDEIWSTQAGMAA
EAVSKKGLKAEQMAAIGITNQRETVVVWNKKTGEPIYNAIVWQDKRTADYCDKLKKEGKS
ELIREKTGLVIDSYFSGTKVKWILDNVEGAREKAEAGDLVLGTIDSWLIWKMTDGGLHIT
DVTNASRSMLFNINTMDWDDELLELLTIPKTMLPEVKQSSEVYGHTTPNLFAKKIPIAGI
AGDQQAALFGQMCTKKGMVKNTYGTGCFMLMNIGEKPIVSENNLLTTVAWKINGKTHYAL
EGSIFIAGAVVQWLRDSLNIIKTSSEVEKLASSVDSSDGVVFVPAFAGLGAPHWNQKAQG
TIFGLTRGSTDAHIARAALESIAYQTMDILKAMEADSGISIKELRVDGGATVNDMLMQFQ
ADVLNTVTVRPKIVETTVMGAAYLAGLAVGYWESPEEIQDIWQTDVHFNPTKERNTIEEG
IKGWYKAIKALEFWTENP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatatatccttgctttggaccaaggtaccactagttcccgtgccgtggtcttc
gacaaaaagggaaccattatttccgtagcccaaaaagaattcacacaaatatttcctaaa
ccgggatgggtagaacacgaccccgacgaaatctggtcgacccaagccgggatggccgca
gaagccgtgagcaaaaaagggttgaaagccgagcaaatggccgctatcggcattaccaat
cagcgggaaaccgttgtggtctggaacaaaaaaacgggagaacccatatataatgccatt
gtttggcaagacaaacgcaccgcagattactgtgataagttgaaaaaagaaggcaaatcc
gaattaattcgagagaaaacaggattggtcatagattcctatttctcgggcactaaggtg
aaatggatattggataatgtagaaggtgccagggaaaaagcagaggccggtgatttggtg
ctcgggaccattgactcttggcttatctggaaaatgacggatggtggacttcatattaca
gatgtgaccaatgcttcacgctccatgctgttcaacattaataccatggattgggatgat
gagcttttggaactgttgaccattcccaaaactatgcttccggaagtaaaacaatccagc
gaagtatatggacatacaactcctaatttattcgccaaaaaaatcccgattgcagggatt
gccggtgatcagcaagccgctttgttcggacaaatgtgcaccaaaaagggcatggtaaaa
aacacctacggaacgggttgctttatgctgatgaatattggagaaaaacctattgtttcc
gaaaataacctccttaccacggtagcttggaaaatcaacggaaaaacccattacgcactc
gaaggaagtatttttattgctggtgcggtggtgcaatggctccgtgatagcttaaatatt
ataaaaacatcttcggaagtggaaaaactagccagttcggtggatagttcggacggagtg
gtttttgttcctgcttttgccggtttgggcgctccgcattggaaccaaaaggcccaagga
actatttttgggctgactcgtggaagtaccgatgcacatattgcacgtgccgctctggaa
tccattgcttaccaaaccatggatattcttaaggccatggaggccgattcgggaatttcc
ataaaagaattgcgtgtagatggaggggccacggtgaatgatatgctcatgcagtttcag
gccgatgtattgaataccgttaccgttaggcccaaaattgtagaaaccacagtaatgggt
gccgcatatttggctggtttggccgttggttattgggagagtccagaggaaatccaagat
atttggcagaccgatgtgcattttaaccctaccaaagaacgtaacaccattgaagaaggc
atcaaagggtggtacaaggccataaaagcgctggaattctggacggaaaacccttaa

DBGET integrated database retrieval system