KEGG   Muricauda ruestringensis: Murru_2942Help
Entry
Murru_2942        CDS       T01598                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mrs  Muricauda ruestringensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Murru_2942
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Murru_2942
Enzymes [BR:mrs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Murru_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3242140..3243447
Genome map
AA seq 435 aa AA seqDB search
MGTFRIEGGHQLHGEITPQGAKNEALQILCAVLLSEEKITINNIPDIVDVNKLIALLEDL
GVKIQKKGSGSYTFKADDVNLDYLQSAKFKEDGRGLRGSIMLVGPLLARFGKGYIPKPGG
DKIGRRRLDTHFEGFIKLGAKFRYNKEEYFYGVEADKLKGTYMLLDEASVTGTANIVMAA
VLAEGTTTIYNAACEPYLQQLCNMLNRMGAKISGIGSNLLTIEGVDSLKGTEHTMLPDMI
EIGSWIGLAAMTQSELTIKNVSWGDLGQIPTVFRKLGINVERRDDDIFIPKHEEGYEIQN
FIDGSILTIADAPWPGLTPDLLSIILVVATQARGEVLIHQKMFESRLFFVDKLIDMGAKI
ILCDPHRATVIGHDFKSTLKATTMVSPDIRAGVSLLIAALSAKGTSTIHNIEQIDRGYEN
IDERLRAIGANIVRV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggtacatttcgaatagagggtggacaccaattgcatggtgaaattactccccaagga
gcaaagaacgaggcacttcagattctttgcgccgtgttgctttcagaagagaaaattacc
ataaacaacataccggacattgtcgatgtcaataaattgattgcccttctcgaagatttg
ggtgtaaaaattcagaaaaagggcagtggttcatatactttcaaggcagacgatgtcaac
ttggattatttacaatccgccaagttcaaagaagatggaagggggcttcggggttccatt
atgctggtagggccattattggcaagatttggcaagggatacattccaaagccaggcggt
gacaagattggcagaagaaggctggacacccattttgaaggctttattaagctcggggca
aagttccgatataataaagaagagtatttctacggggtagaagccgataaactgaagggt
acctacatgcttttggatgaagcatcggtaacaggtaccgccaacattgtgatggccgct
gttttggccgaaggtacaactaccatttacaatgccgcttgtgagccttatttacagcaa
ttgtgcaatatgttgaaccgcatgggggctaaaatctccggaataggatcaaatctgttg
actattgaaggtgtggattccttgaaaggaacagagcataccatgttgcccgatatgatc
gagattggtagctggataggtttagctgcaatgacgcaaagcgagcttaccataaaaaat
gtgagttggggcgatttaggtcagattccaacggtattccgaaagttgggaataaacgtg
gagcgaagggatgatgatatctttatcccgaaacacgaagaaggctacgaaatccaaaat
tttatcgatggatctattctcactattgccgatgcaccatggcctggactgactccggat
ttgttgagcatcatattagtggttgccacacaagcaaggggagaagtactcattcatcaa
aaaatgttcgaaagccgtttgttctttgtggacaaacttattgatatgggggcaaaaatt
attctttgcgacccacaccgggccacagttattgggcacgactttaaatcaacattaaag
gccaccaccatggtttctcctgatattagggcaggtgtatcacttttgatagcagcactt
tctgccaagggtacttccaccattcataatattgagcagattgatcgtggttatgagaac
attgatgagcgcttgcgagccattggcgccaatattgttagggtttaa

DBGET integrated database retrieval system