KEGG   Metallosphaera sedula: Msed_0223Help
Entry
Msed_0223         CDS       T00509                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00030  Pentose phosphate pathway
mse00051  Fructose and mannose metabolism
mse00052  Galactose metabolism
mse00230  Purine metabolism
mse00500  Starch and sucrose metabolism
mse00520  Amino sugar and nucleotide sugar metabolism
mse00521  Streptomycin biosynthesis
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0223
   00030 Pentose phosphate pathway
    Msed_0223
   00051 Fructose and mannose metabolism
    Msed_0223
   00052 Galactose metabolism
    Msed_0223
   00500 Starch and sucrose metabolism
    Msed_0223
   00520 Amino sugar and nucleotide sugar metabolism
    Msed_0223
  Nucleotide metabolism
   00230 Purine metabolism
    Msed_0223
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msed_0223
Enzymes [BR:mse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msed_0223
    5.4.2.8  phosphomannomutase
     Msed_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABP94400
UniProt: A4YD98
Position
184929..186287
Genome map
AA seq 452 aa AA seqDB search
MGKLFGTDGVRGIVNQELTVELAQGLGKAIGTFFGEGSNILLGRDARAGGDMLSRAVESG
LLSTGVRVFEGGFAPTPALQYAVKTLGYDGGVIITASHNPREHNGIKVLDRDGVEVSREK
EDKIEEIYFSGRFNVVPWNRLTYDVKRDDRVIDTYVQGVLSHVDVEKIRARNFKVLVDGA
NSVGSISTPMVARLLGCKIFTINANLDPTFPARNPEPTMESLKETAGIASSLKVDLAVAH
DGDADRAIFIDSKGRVQWGDRSGSLLSWWASGKVNFPRRIFTAVSSSSLVQEFLSRYGIE
VVWTKVGSVDIARKLIQEKGIAGFEENGGFIFPGHQYVRDGAMSFALMLEMMASEGVSSA
DLFDRLPQYYLVKTKVDLKPGMDVARIYEKVERELGTGNQVVKIDGVKIIGKDFWILVRK
SGTEPIIRVMVEAKEQGMAESLANQVKALIGA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactgtttggtacagacggagttagaggaatagtaaaccaggagttaacagtg
gaactggctcaagggttgggtaaggcaataggcacgttctttggagagggtagcaacatc
ctcctggggagggacgcgagggcaggaggggacatgttaagcagggcggttgagagcggt
ttacttagtacaggggtaagagtctttgagggaggatttgcgcccactccggcgcttcaa
tacgctgtaaaaacacttggctatgacggtggagtgataataaccgcgagtcataaccca
agggaacataatgggattaaggttctggatagggacggcgttgaagtctctagggaaaag
gaggacaagatagaggaaatatacttctcaggaaggttcaacgtcgtcccctggaatagg
ctaacatacgacgtaaagagagatgacagggtaatagacacttacgttcagggagttcta
tcccacgttgatgtagaaaagataagggcaaggaacttcaaggtactcgtggatggtgcc
aatagcgttggatcaatttcaactccaatggtcgcaagattactgggttgtaagatcttc
acaatcaacgcaaacttagatcctactttccctgcaaggaacccagagccgaccatggaa
tctcttaaggagactgcagggattgcctcgtctcttaaggtggacttggcagtagctcat
gacggggatgcagatagggcgatctttatagactctaagggtagggtgcaatggggagat
aggagcggttctctgctcagttggtgggcttcaggtaaggtgaacttccccaggagaata
ttcactgcagtttccagttcctcgctggttcaagagttcctatctcgttatggaatagag
gttgtatggactaaggtgggaagtgtggatattgccagaaaacttatccaagaaaagggg
atagcgggctttgaggagaacggtggattcattttcccaggacaccagtatgtgagggac
ggtgcaatgtcctttgccctcatgttggagatgatggcctctgagggggttagctcggcc
gacctcttcgatagactaccccagtattatttggtcaaaaccaaggttgatcttaagcca
gggatggacgttgccagaatctatgaaaaggtggaaagagagcttggcacagggaaccag
gtggttaagattgacggtgtaaagatcattgggaaagacttctggatcctagtgagaaag
agcggtactgagccaataattagggtgatggttgaggctaaggagcagggaatggctgaa
agcttggcaaaccaagtcaaagccctgataggtgcttga

DBGET integrated database retrieval system