KEGG   Metallosphaera sedula: Msed_0223Help
Entry
Msed_0223         CDS       T00509                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0223
   00030 Pentose phosphate pathway
    Msed_0223
   00051 Fructose and mannose metabolism
    Msed_0223
   00052 Galactose metabolism
    Msed_0223
   00500 Starch and sucrose metabolism
    Msed_0223
   00520 Amino sugar and nucleotide sugar metabolism
    Msed_0223
  Nucleotide metabolism
   00230 Purine metabolism
    Msed_0223
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msed_0223
Enzymes [BR:mse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msed_0223
    5.4.2.8  phosphomannomutase
     Msed_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184929..186287
Genome map
AA seq 452 aa AA seqDB search
MGKLFGTDGVRGIVNQELTVELAQGLGKAIGTFFGEGSNILLGRDARAGGDMLSRAVESG
LLSTGVRVFEGGFAPTPALQYAVKTLGYDGGVIITASHNPREHNGIKVLDRDGVEVSREK
EDKIEEIYFSGRFNVVPWNRLTYDVKRDDRVIDTYVQGVLSHVDVEKIRARNFKVLVDGA
NSVGSISTPMVARLLGCKIFTINANLDPTFPARNPEPTMESLKETAGIASSLKVDLAVAH
DGDADRAIFIDSKGRVQWGDRSGSLLSWWASGKVNFPRRIFTAVSSSSLVQEFLSRYGIE
VVWTKVGSVDIARKLIQEKGIAGFEENGGFIFPGHQYVRDGAMSFALMLEMMASEGVSSA
DLFDRLPQYYLVKTKVDLKPGMDVARIYEKVERELGTGNQVVKIDGVKIIGKDFWILVRK
SGTEPIIRVMVEAKEQGMAESLANQVKALIGA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactgtttggtacagacggagttagaggaatagtaaaccaggagttaacagtg
gaactggctcaagggttgggtaaggcaataggcacgttctttggagagggtagcaacatc
ctcctggggagggacgcgagggcaggaggggacatgttaagcagggcggttgagagcggt
ttacttagtacaggggtaagagtctttgagggaggatttgcgcccactccggcgcttcaa
tacgctgtaaaaacacttggctatgacggtggagtgataataaccgcgagtcataaccca
agggaacataatgggattaaggttctggatagggacggcgttgaagtctctagggaaaag
gaggacaagatagaggaaatatacttctcaggaaggttcaacgtcgtcccctggaatagg
ctaacatacgacgtaaagagagatgacagggtaatagacacttacgttcagggagttcta
tcccacgttgatgtagaaaagataagggcaaggaacttcaaggtactcgtggatggtgcc
aatagcgttggatcaatttcaactccaatggtcgcaagattactgggttgtaagatcttc
acaatcaacgcaaacttagatcctactttccctgcaaggaacccagagccgaccatggaa
tctcttaaggagactgcagggattgcctcgtctcttaaggtggacttggcagtagctcat
gacggggatgcagatagggcgatctttatagactctaagggtagggtgcaatggggagat
aggagcggttctctgctcagttggtgggcttcaggtaaggtgaacttccccaggagaata
ttcactgcagtttccagttcctcgctggttcaagagttcctatctcgttatggaatagag
gttgtatggactaaggtgggaagtgtggatattgccagaaaacttatccaagaaaagggg
atagcgggctttgaggagaacggtggattcattttcccaggacaccagtatgtgagggac
ggtgcaatgtcctttgccctcatgttggagatgatggcctctgagggggttagctcggcc
gacctcttcgatagactaccccagtattatttggtcaaaaccaaggttgatcttaagcca
gggatggacgttgccagaatctatgaaaaggtggaaagagagcttggcacagggaaccag
gtggttaagattgacggtgtaaagatcattgggaaagacttctggatcctagtgagaaag
agcggtactgagccaataattagggtgatggttgaggctaaggagcagggaatggctgaa
agcttggcaaaccaagtcaaagccctgataggtgcttga

DBGET integrated database retrieval system