KEGG   Metallosphaera sedula: Msed_1980Help
Entry
Msed_1980         CDS       T00509                                 

Definition
phosphoribosylformylglycinamidine synthase II (EC:6.3.5.3)
Orthology
K01952  
phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
Organism
mse  Metallosphaera sedula
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mse00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1913092..1915200
Genome map
AA seq 702 aa AA seqDB search
MILTLSKTEMEVVRRVLGREPKEAEWKLVDALWSEHCSYKSSKVFLRSLPSTGPNVIMSV
EDWQDAGAVDVGDGLALVLKVESHNHPSAIDPFNGAATGVGGILRDIISKGAKPIALLDM
IRVGKLDDKGKWLLKNIISGIGFYGNSVGVPVVGGELSFDETYNDNPLVDVACAGIVSKD
SIVPSVVREPGLRLVLAGFTGLDGLGGASFASRKLSGMDEIGAVQIADPFAGKIIIDVTL
EIAKEVEAIKDLGGGGLAVAVTEMANGLGAVVNLERVPLRFEYLSPEDIIISETQERMLF
AVKPEKVESVCAKFREYNYPCEDIGEITAEPKVRFLYNGEPVAELPSDLLLSPPLNVWPA
ERKPRKREPEREVALGEALRAVLTHPDLVSKEWAYSQFDYEVGTSTVVKPGQGDSAVVEL
PNGKYLALKGDANQDLCAEDAYECGKAIVAEAYRNLATVGARGIALVDHLQFGDPRKPHV
YQDFIDAVRGISEASKFFSIPVVGGKVSFHNEDKNGNPIKPTPLVVMAGLVEGKLARNRV
EEGDLVLIGETRNELAGTLFSRIFGGGGEVAKTRLMEDLIASNLVIKGINEGKITWNKDV
SKGGLAGALLPILAKGFSVRISSSQVIGTSNLLGKMFSESGGRFLVLTSDPQWFMYQAGR
MGIQALAIGKVTKDGSKLVLDYETFPMDSIVENYYSFLEGSL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcacgttatccaagactgagatggaggtagtgaggagggttctcgggagggaa
cccaaggaagctgagtggaagcttgtggatgcactttggtcggagcattgttcctacaag
agctcgaaggtattccttaggagcttgcccagtacaggtcccaacgtgataatgagcgtt
gaggactggcaggacgccggtgccgtggacgtgggtgatggtctagccctggtcctcaag
gttgagagccacaaccatccctcagccatagatcccttcaacggtgcagctacgggagtt
gggggaatcctaagggatatcataagtaagggagcgaaacccatagccctcctcgacatg
ataagggttggcaaactggatgacaaggggaagtggctactcaagaacataatctcaggg
ataggcttttacgggaacagcgtcggggtacctgtagtcggaggagagctgtccttcgac
gaaacgtataacgataatccgctcgtggacgtggcctgcgcaggtatagtgagcaaagac
tccatagtccccagcgtggttcgggagccaggtctcaggctcgtgttggcaggcttcact
ggacttgacggtctagggggagcctcgtttgcctctaggaaattgagcggaatggatgag
ataggggcagttcagatagctgatccctttgcggggaagataatcattgacgtaaccctt
gagatcgccaaggaggttgaggcaataaaggacctcggtggtgggggactagcagttgcc
gttactgagatggccaacggattgggggcagtggttaacctggagagggtaccactgagg
tttgagtacctctcgccagaggacatcataatatccgagacccaggagagaatgctcttt
gcggtgaagcccgagaaagtggagtccgtgtgcgccaagttcagggagtacaactacccc
tgtgaggacataggcgagatcacggccgaacccaaggtgaggttcctgtataatggtgag
cctgtggcggagctaccctcagaccttctcctatctcccccactcaatgtctggccagct
gagaggaagccgaggaaaagagagcctgaaagggaagtcgccctaggcgaggcactgagg
gcagtcctcacacatcctgaccttgtgagcaaggagtgggcctactcccagttcgattac
gaggtggggacgtccaccgtggtgaagcctggacagggtgacagcgcggttgtggagttg
cccaatgggaaatacctggcgcttaagggggatgcaaatcaggacctatgtgccgaggac
gcttacgagtgcggtaaagccatagtagcagaggcctacaggaatctggcaacagttggg
gcgagaggaatagcccttgtggaccatctgcagtttggcgatccaaggaagcctcacgtc
tatcaggacttcattgacgctgtgaggggaatatcggaggcttccaagttcttctcgata
cccgttgtgggcggaaaggtctcgttccacaacgaggataagaacggtaatcccataaag
cctacacccctggtggtgatggctgggctagttgagggcaagctggccagaaatagggta
gaggaaggagatctagtgctaattggggagactaggaacgagctggctggaacccttttc
tccaggatatttggaggaggaggcgaggtggccaaaaccagattaatggaggacctaata
gcgtcgaacctggtaataaagggaataaacgagggtaagataacttggaacaaggatgtc
tccaagggcggtctagccggagcacttctcccaatcctagctaagggattctccgtgagg
atctcctcctcccaggtaatcggtacctcaaatctcctgggcaagatgttctcggagagc
ggtggaaggtttctagtcctcaccagtgatccgcagtggttcatgtaccaggctggcagg
atgggaatacaggcgttggccatagggaaggtgaccaaggatgggagcaagctcgttcta
gattacgagacctttcccatggactctatcgtggagaactactactcctttctggaggga
tcgctatga

DBGET integrated database retrieval system