KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4092Help
Entry
MSMEI_4092        CDS       T02191                                 

Gene name
cysQ
Definition
inositol monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MSMEI_4092 (cysQ)
Enzymes [BR:msg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MSMEI_4092 (cysQ)
Transfer RNA biogenesis [BR:msg03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MSMEI_4092 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4271728..4272489)
Genome map
AA seq 253 aa AA seqDB search
MTSTDAELAAAVAKEAGELLLGIREEVGFYDPYYLGDEGDRRSNALILKRLAEARPSDSV
LSEEAADNLARVRADRVWIVDPVDGTREFSMPGREDWAVHIALWQRSVGVDGGLSDAVVA
LPARGEVYRSDTITPPPPREPGPILITASSNRPPAVLWRMREHLDFRMVRIGSAGAKAMA
VVRGDVDAYIHAGGQWEWDSAAPAGVLLAAGMHASRLDGSELRYNREDPYLPDFVMCRRE
LAPVLLDAIGAAL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcgaccgatgccgaactggccgctgcagtagccaaggaggccggcgagctgttg
ctggggatccgtgaggaggtcgggttctacgacccgtactacctcggcgacgagggggac
cggcggtccaacgccctgatcctcaagcgcctggccgaggccaggcccagtgattcggtg
ctcagcgaggaggccgccgacaatctcgcccgcgtccgtgccgaccgcgtgtggatcgtc
gacccggtcgacggcacccgcgagttctccatgcccggccgcgaggactgggccgtgcac
atcgcgctgtggcagcgctcggtgggcgtcgacggcggcctgtccgacgctgtcgtggcg
ctgcctgcgcgcggcgaggtctatcgcagcgacacgatcaccccgccgccgccgcgcgag
ccggggccgatcctgatcaccgcgagctccaaccgcccgcccgcggtgctgtggcgcatg
cgcgagcacctcgacttccgcatggtgcgcatcggctcggcaggtgccaaggcgatggcc
gtggtccgcggcgacgtcgacgcctacatccacgccggcggccagtgggagtgggattcc
gcggctccggccggtgtgctgctcgcggcgggcatgcacgcgtcccggctggacggctcg
gagttgcggtacaaccgcgaagacccgtaccttccggacttcgtgatgtgccggcgtgag
ctggcgcccgtgctgctcgacgcgatcggagccgccttgtga

DBGET integrated database retrieval system