KEGG   Mycobacterium smegmatis MC2 155: MSMEI_4092Help
Entry
MSMEI_4092        CDS       T02191                                 

Gene name
cysQ
Definition
inositol monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
msg  Mycobacterium smegmatis MC2 155
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:msg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4271728..4272489)
Genome map
AA seq 253 aa AA seqDB search
MTSTDAELAAAVAKEAGELLLGIREEVGFYDPYYLGDEGDRRSNALILKRLAEARPSDSV
LSEEAADNLARVRADRVWIVDPVDGTREFSMPGREDWAVHIALWQRSVGVDGGLSDAVVA
LPARGEVYRSDTITPPPPREPGPILITASSNRPPAVLWRMREHLDFRMVRIGSAGAKAMA
VVRGDVDAYIHAGGQWEWDSAAPAGVLLAAGMHASRLDGSELRYNREDPYLPDFVMCRRE
LAPVLLDAIGAAL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgacatcgaccgatgccgaactggccgctgcagtagccaaggaggccggcgagctgttg
ctggggatccgtgaggaggtcgggttctacgacccgtactacctcggcgacgagggggac
cggcggtccaacgccctgatcctcaagcgcctggccgaggccaggcccagtgattcggtg
ctcagcgaggaggccgccgacaatctcgcccgcgtccgtgccgaccgcgtgtggatcgtc
gacccggtcgacggcacccgcgagttctccatgcccggccgcgaggactgggccgtgcac
atcgcgctgtggcagcgctcggtgggcgtcgacggcggcctgtccgacgctgtcgtggcg
ctgcctgcgcgcggcgaggtctatcgcagcgacacgatcaccccgccgccgccgcgcgag
ccggggccgatcctgatcaccgcgagctccaaccgcccgcccgcggtgctgtggcgcatg
cgcgagcacctcgacttccgcatggtgcgcatcggctcggcaggtgccaaggcgatggcc
gtggtccgcggcgacgtcgacgcctacatccacgccggcggccagtgggagtgggattcc
gcggctccggccggtgtgctgctcgcggcgggcatgcacgcgtcccggctggacggctcg
gagttgcggtacaaccgcgaagacccgtaccttccggacttcgtgatgtgccggcgtgag
ctggcgcccgtgctgctcgacgcgatcggagccgccttgtga

DBGET integrated database retrieval system