KEGG   Methanobrevibacter smithii: Msm_0160Help
Entry
Msm_0160          CDS       T00539                                 

Definition
asparagine synthetase, AsnB (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
msi  Methanobrevibacter smithii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Msm_0160
Enzymes [BR:msi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Msm_0160
Peptidases [BR:msi01002]
 Cysteine Peptidases
  Family C44
   Msm_0160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(150953..152380)
Genome map
AA seq 475 aa AA seqDB search
MCSIVGLQGNFKADDLIAMLKTSKNRGKDASGIFLDGKIQKGIDLNDFNDKNAYYLGLGH
NLLAVHNLENRTSHTQPIAKNTLTLVFNGEIYNYSSLKNLLAKLTKNDNINSDSELLINL
IDFYYKDDLLRAVTQVNNLLDGDYAYAVTDGINLAVSRDPLGVKPLFYTHNAFASSKQCL
KGDIKTLKPGHILYNWEEIPPKTDIFQKRFETDNRKLEKLLKLAVLKRVEDLNEVGVIFS
GGVDSSLIALLLREISLNKNLKVTLYAVGKKDSKDVVAAKCVAEYLGLPLKVHDITESIV
KDSLKDVVQAIGENNLMKIGVGMTVYLASKMIVEDNIKVAISGQGADELFGGYNRYLNSY
MENTLDDELRYDMANMYHVNLERDDACSMANGVELRLPFLDKNLVEFALNIPVRYKISGS
DDKLRKNILRKTAFNLGLDKQIAYRPKKAAQYGTGIDKILRKKVLKDTDIEEYLK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatagttggtcttcaaggtaatttcaaagctgatgatttaatagctatgtta
aaaacatcaaaaaataggggaaaagatgcttcaggaatatttttagatggtaaaatacaa
aaaggtattgatttaaatgatttcaatgataaaaacgcttattatttaggtttaggccat
aatctgctggctgtccataatttggaaaacagaacttcccatactcagccgatagctaaa
aacactctgactctggttttcaatggtgagatttataattattcttccctaaagaatttg
ctggctaaactgacaaaaaatgacaatataaattctgattctgagttattaattaatctg
attgatttttattataaggatgaccttttaagagcagtaactcaggtcaataatcttttg
gatggggattatgcttatgctgttacagatggcattaacttggctgtttcaagagatcct
ttaggtgtcaaacctttattttacacacataatgcttttgcttcttcaaaacagtgcttg
aaaggagatatcaaaacattaaagccgggacatatactttacaactgggaagagatacct
cctaaaacggatattttccagaagaggtttgaaaccgacaacagaaaacttgaaaagctt
cttaaactggctgttttaaaaagggttgaggatttgaatgaagttggagtaatattttca
ggaggtgttgacagctctttgatagctttgctgcttcgggaaatatctttaaataaaaat
cttaaagttactttgtatgctgtcggtaaaaaggattccaaggatgtggttgcagctaag
tgtgtagccgagtatttgggtcttcctctaaaggttcatgacattacggaaagtattgta
aaggacagtcttaaagatgttgttcaggcaattggtgaaaacaatctgatgaagattgga
gtgggaatgactgtttatcttgcttctaaaatgatagttgaagataatattaaggtagct
atttccggtcagggtgctgatgagctgtttgggggctataacagatatctgaatagctat
atggaaaatactttagatgatgaattaagatatgatatggctaatatgtatcatgttaat
ctggaacgtgatgatgcatgctcaatggcaaatggcgttgagctgcgtcttcctttttta
gataagaatcttgttgaatttgccctcaatattccggtcagatataagatttcaggttct
gatgataagctgcgcaaaaatattttaagaaaaacggctttcaatttgggactggataag
cagattgcttacagacctaaaaaggcagcccagtacggcacgggtattgacaaaatttta
agaaaaaaagttttaaaggatactgatattgaggagtatttaaaatag

DBGET integrated database retrieval system