KEGG   Moorella thermoacetica: Moth_1369Help
Entry
Moth_1369         CDS       T00308                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mta  Moorella thermoacetica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Moth_1369
   00052 Galactose metabolism
    Moth_1369
   00500 Starch and sucrose metabolism
    Moth_1369
   00520 Amino sugar and nucleotide sugar metabolism
    Moth_1369
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Moth_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1414715..1415659
Genome map
AA seq 314 aa AA seqDB search
MNRRENKNEVISLTRIQKAIIPAAGWGTRFLPATKAQPKEMLPIVDKPAIQFIVEEAVNA
GAEDILIITGKNKRAIEDHFDRSLELENLLREKGKDELLALVEGIAELADIHYIRQKEQL
GLGHAVYCARKFIGQEPFAVLLGDDIIVNSPSCLEQMLAVYEEVGATIVAVQEVPREEVN
RYGVIDPLEVDGSLIRVRDLVEKPRPEEAPSNLAVIGRYILVPAIFPLLEKVKPGAGGEI
QLTDALRLLARQDRVYAYRFQGKRYDIGDKLGFLQATVEFALARPDLAGPFSEYLAGIIT
STADKLQVAATREG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacgtgaaaataagaacgaggtgatatctttgaccaggattcagaaagctatc
attcccgctgccggctggggtacccgtttcctgccggccaccaaagcccagcccaaggaa
atgttacccattgttgacaaaccggccattcaattcatcgtcgaagaagccgttaatgcc
ggtgcggaggatatcctgattatcaccggtaaaaataaacgagccatcgaggaccacttt
gaccgttccctggaactggagaacctcttgcgggaaaagggaaaggacgaactcctggcc
ctggtggaggggattgctgaactcgccgatatccactacatccgccagaaggagcaactg
ggcctggggcacgccgtttactgtgcccgcaaatttatcggccaggaaccctttgccgtc
ctcctgggggatgatattatcgtcaactccccctcctgcctggaacagatgctcgccgtt
tatgaagaagtcggggctaccatagtcgccgtccaggaggtgccccgggaggaagtaaac
cgttacggtgtcattgaccccctggaagtcgacggctccctcatccgggtcagggacctg
gttgagaagccgcgccccgaggaagccccttccaatctggccgtcattggtcgttacatc
ctggtgccggcgatcttccctctcctggagaaagtaaaaccgggcgctggcggcgagatc
cagctgaccgacgccctgcgcctgctggcccgccaggaccgtgtctatgcctaccgtttc
cagggtaagcgctacgacatcggtgacaagctgggctttctccaggccacggtggaattt
gccctagcccgcccggatctcgccggcccctttagcgagtacctggccggcatcattact
tccactgcggacaagttgcaggttgccgccaccagggaaggataa

DBGET integrated database retrieval system