KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_03513Help
Entry
TBMG_03513        CDS       T00940                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase rmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    TBMG_03513
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TBMG_03513
Enzymes [BR:mtb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     TBMG_03513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3872651..3873259
Genome map
AA seq 202 aa AA seqDB search
MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG
LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG
FLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV
RASGLLPRWEQTQRFIGEMRGT
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacgcgaactcgacgtccccggcgcctgggagattaccccgaccatccatgtc
gattcccgcggactgttcttcgaatggcttaccgatcatgggttccgcgcattcgcaggt
cacagtttggacgtccggcaagtgaactgctcggtgtcatcggccggtgtgctgcgcggc
ctgcactttgcccagttgccgccgagccaggccaagtatgtgacctgcgtttccggctcg
gtgttcgatgtcgtcgtcgacatccgagagggctcaccgacattcggccgatgggactcg
gtgctgctcgacgaccaagaccgtaggacgatctacgtctccgaaggcctagcgcacggc
ttccttgcactgcaagacaattcgacggtgatgtacttgtgctcggcggaatacaatccg
cagcgcgagcacaccatctgcgccacagatccgacgttggcggtcgattggccgctggtc
gatggcgctgcccccagcctgtccgaccgtgatgccgctgcgcccagcttcgaggatgtg
cgcgcgtctggcctgctgcccaggtgggaacagacgcagcggttcattggggagatgcgc
ggcacctag

DBGET integrated database retrieval system