KEGG   Mycobacterium tuberculosis UT205: UDA_0727cHelp
Entry
UDA_0727c         CDS       T02142                                 

Gene name
fucA
Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mtd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821787..822443)
Genome map
AA seq 218 aa AA seqDB search
MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLV
DAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEF
AIYGGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVE
RTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgttgacgacccggaatccgcggtgctggcggccgccaaggacatgttgcgt
cggggcctggtcgaggggaccgccggaaatatctcagccaggcgctcggacggcaacgtg
gtcatcacgccgtcctcggtcgactacgccgagatgctgctccacgatctggtgctagtc
gacgccggcggtgcggtgctgcacgccaaggacggccggtcgccgtcgaccgaactaaac
ctacacctggcgtgctatcgcgcattcgacgacattggcagcgtgatccacagccacccg
gtgtgggcgaccatgttcgccgtcgcccatgagccgattcccgcctgcatcgacgagttc
gcgatctacggcggcggggacgttcgctgcaccgagtacgccgcgtccggtacacccgag
gtcggccgcaacgcggtgcgcgcgcttgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggccgtggggccccgccccgaccaggtgctgcgcgtcaccgcccttgttgag
cgcaccgcacaaatcgtttggggtgcccgcgctctcggtggaccggtgccaattcctgag
gacgtgtgccgtaacttcacgggcgtctacggctatctgcgcgcgaatccgctctag

DBGET integrated database retrieval system