KEGG   Mycobacterium tuberculosis UT205: UDA_0727cHelp
Entry
UDA_0727c         CDS       T02142                                 

Gene name
fucA
Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mtd  Mycobacterium tuberculosis UT205
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UDA_0727c (fucA)
Enzymes [BR:mtd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     UDA_0727c (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821787..822443)
Genome map
AA seq 218 aa AA seqDB search
MNFVDDPESAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYAEMLLHDLVLV
DAGGAVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHPVWATMFAVAHEPIPACIDEF
AIYGGGDVRCTEYAASGTPEVGRNAVRALEGRAAALIANHGLVAVGPRPDQVLRVTALVE
RTAQIVWGARALGGPVPIPEDVCRNFTGVYGYLRANPL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgttgacgacccggaatccgcggtgctggcggccgccaaggacatgttgcgt
cggggcctggtcgaggggaccgccggaaatatctcagccaggcgctcggacggcaacgtg
gtcatcacgccgtcctcggtcgactacgccgagatgctgctccacgatctggtgctagtc
gacgccggcggtgcggtgctgcacgccaaggacggccggtcgccgtcgaccgaactaaac
ctacacctggcgtgctatcgcgcattcgacgacattggcagcgtgatccacagccacccg
gtgtgggcgaccatgttcgccgtcgcccatgagccgattcccgcctgcatcgacgagttc
gcgatctacggcggcggggacgttcgctgcaccgagtacgccgcgtccggtacacccgag
gtcggccgcaacgcggtgcgcgcgcttgagggccgcgccgccgccctgatcgccaaccac
ggcctggtggccgtggggccccgccccgaccaggtgctgcgcgtcaccgcccttgttgag
cgcaccgcacaaatcgtttggggtgcccgcgctctcggtggaccggtgccaattcctgag
gacgtgtgccgtaacttcacgggcgtctacggctatctgcgcgcgaatccgctctag

DBGET integrated database retrieval system