KEGG   Mycobacterium tuberculosis CCDC5079: CCDC5079_2483Help
Entry
CCDC5079_2483     CDS       T01991                                 

Definition
(GenBank) polyphosphate glucokinase PPGK
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mte  Mycobacterium tuberculosis CCDC5079
Pathway
mte00010  Glycolysis / Gluconeogenesis
mte00520  Amino sugar and nucleotide sugar metabolism
mte01100  Metabolic pathways
mte01110  Biosynthesis of secondary metabolites
mte01120  Microbial metabolism in diverse environments
mte01130  Biosynthesis of antibiotics
mte01200  Carbon metabolism
Module
mte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mte_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCDC5079_2483
   00520 Amino sugar and nucleotide sugar metabolism
    CCDC5079_2483
Enzymes [BR:mte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CCDC5079_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEJ47673
Position
2997557..2998354
Genome map
AA seq 265 aa AA seqDB search
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAV
AKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTI
LNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAE
ERAASSVKEKNDWTYPKWAKQVTRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTP
VVPAALQNTAGIVGAAMASVADTTH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccggccccgagacgtccgaaacaccgggtgccacgacacagcgtcatggc
ttcggcatcgacgtcggcggcagcggcatcaagggcggaatcgtcgacttggacaccggc
cagctgatcggcgaccggatcaagctgctgaccccgcaaccggccactccgttggcggtc
gccaaaaccatcgccgaggtcgtcaacggtttcggctggcggggtccgctgggggtgacc
tatcccggcgtcgtcactcacggcgtcgtccggaccgcggctaacgtggacaagtcctgg
atagggaccaacgcacgcgacactatcggcgccgagctgggcggtcagcaggtcaccatc
ctcaacgacgctgatgccgccgggctggccgagacacgctacggggccggcaagaacaac
cctggcttagtggtactgctcacattcggaaccgggatcgggtccgcggtcatccacaac
gggacgttgatacccaacaccgagttcggacatcttgaggtcggcggcaaggaagcggag
gaaagggccgcctcctcggtaaaggaaaagaacgactggacctatccaaagtgggccaag
caggtgacacgcgtgctcatcgccatcgagaacgcgatctggcctgacctgttcatcgcc
ggcggcggcatcagccgcaaggccgacaaatgggtgccgctactggaaaaccgcacacca
gtagtgcccgcggccctgcagaacaccgccggaattgtcggtgcggccatggcctctgtc
gcagatacgacgcactga

DBGET integrated database retrieval system