KEGG   Mycobacterium tuberculosis H37Rv: Rv0422cHelp
Entry
Rv0422c           CDS       T00015                                 

Gene name
thiD
Definition
(RefSeq) hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
  KO
K00941  
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Rv0422c (thiD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     Rv0422c (thiD)
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphooxymethylpyrimidine kinase
     Rv0422c (thiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(507758..508555)
Genome map
AA seq 265 aa AA seqDB search
MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQNTLGVKDIHEVPNDVV
AGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLVVDPVCASMHGDPLLAP
SALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAKALHALGPQWVLVKGGHL
RSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAAALAHGFTVPDAVDFGKRW
VTECLRAAYPLGRGHGPVSPLFRLS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgccgcgggtgttgagcatcgccggatcggactccgggggcggtgccggcatc
caagccgatatgcgcacgatggcactgctaggagtgcacgcgtgcgtcgcagtcacggcg
gttaccgtacagaacacgttgggagtcaaggatattcatgaagttcccaacgatgtggtg
gccggccagatcgaggcggtcgtcaccgacatcggcgttcaagccgccaagaccgggatg
ctggcctcgtcgcgcatcgttgcgaccgtggccgcgacctggcgtcggctcgagctgtcc
gttccgctcgtcgtcgacccggtatgcgcatccatgcacggagacccgctgttggcaccg
tctgccctggattcgcttcgcggtcagctgttcccgttggcgacgctgctgacccccaac
cttgacgaggcgcgcctgctggtagatatcgaggtagtcgacgccgagtcgcagcgtgcg
gcggccaaagccctgcatgcgctggggccgcagtgggtgctggtcaaaggcggacacctg
cgctcgtcggacggcagctgcgacctgctctatgacggcgtcagctgctaccagttcgac
gcgcagcgactacccaccggcgatgaccatggcggtggtgacacgctggcgaccgcgatc
gccgccgcgttggcgcacggcttcaccgtgcccgacgcggtggacttcgggaagcgatgg
gttaccgaatgcctgcgcgcggcctatccactgggccgcggccacgggcccgtttcgccg
ctgtttcggctgtcatga

DBGET integrated database retrieval system