KEGG   Mycobacterium tuberculosis H37Rv: Rv1885cHelp
Entry
Rv1885c           CDS       T00015                                 

Gene name
*MtCM
Definition
(RefSeq) chorismate mutase
  KO
K04093  
chorismate mutase [EC:5.4.99.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1885c (*MtCM)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1885c (*MtCM)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     Rv1885c (*MtCM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2134273..2134872)
Genome map
AA seq 199 aa AA seqDB search
MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcttacccgtccacgtgagatatacctcgcgaccgccgtctcgatcggcatcctgttg
tcgctgattgcaccactaggccccccgctggcgcgagccgacggcaccagccagttagcc
gagttggtcgacgccgccgctgagcggttggaggtcgccgacccggtggcagccttcaag
tggcgtgctcagctgcccattgaggattccggccgagtcgaacagcaactcgcaaagttg
ggcgaagatgcccgctcgcagcacatcgaccccgactacgtcacccgcgtcttcgacgac
cagattcgcgccaccgaggcaatcgagtacagccggttctcggactggaagctcaacccg
gccagcgcgcccccggagccgccggatctatcggcatcgcgatcggcgatcgactccctg
aataatcggatgctgtcgcagatttggagtcactggagtttgctgtccgcgccgtcctgc
gccgcccaactcgaccgcgccaaacgcgacatagtgcggtcccgccacctcgatagcctc
tatcaacgggccctgacgacagcaacacagtcgtattgccaggccctaccgccggcctga

DBGET integrated database retrieval system