KEGG   Mycobacterium tuberculosis H37Rv: Rv2531cHelp
Entry
Rv2531c           CDS       T00015                                 

Gene name
adi
Definition
(RefSeq) amino acid decarboxylase
  KO
K01584  
arginine decarboxylase [EC:4.1.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv2531c (adi)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     Rv2531c (adi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2854938..2857781)
Genome map
AA seq 947 aa AA seqDB search
MNPNSVRPRRLHVSALAAVANPSYTRLDTWNLLDDACRHLAEVDLAGLDTTHDVARAKRL
MDRIGAYERYWLYPGAQNLATFRAHLDSHSTVRLTEEVSLAVRLLSEYGDRTALFDTSAS
LAEQELVAQAKQQQFYTVLLADDSPATAPDSLAECLRQLRNPADEVQFELLVVASIEDAI
TAVALNGEIQAAIIRHDLPLRSRDRVPLMTTLLGTDGDEAVANETHDWVECAEWIRELRP
HIDLYLLTDESIAAETQDEPDVYDRTFYRLNDVTDLHSTVLAGLRNRYATPFFDALRAYA
AAPVGQFHALPVARGASIFNSKSLHDMGEFYGRNIFMAETSTTSGGLDSLLDPHGNIKTA
MDKAAVTWNANQTYFVTNGTSTANKIVVQALTRPGDIVLIDRNCHKSHHYGLVLAGAYPM
YLDAYPLPQYAIYGAVPLRTIKQALLDLEAAGQLHRVRMLLLTNCTFDGVVYNPRRVMEE
VLAIKPDICFLWDEAWYAFATAVPWARQRTAMIAAERLEQMLSTAEYAEEYRNWCASMDG
VDRSEWVDHRLLPDPNRARVRVYATHSTHKSLSALRQASMIHVRDQDFKALTRDAFGEAF
LTHTSTSPNQQLLASLDLARRQVDIEGFELVRHVYNMALVFRHRVRKDRLISKWFRILDE
SDLVPDAFRSSTVSSYRQVRQGALADWNEAWRSDQFVLDPTRLTLFIGATGMNGYDFREK
ILMERFGIQINKTSINSVLLIFTIGVTWSSVHYLLDVLRRVAIDLDRSQKAASGADLALH
RRHVEEITQDLPHLPDFSEFDLAFRPDDASSFGDMRSAFYAGYEEADREYVQIGLAGRRL
AEGKTLVSTTFVVPYPPGFPVLVPGQLVSKEIIYFLAQLDVKEIHGYNPDLGLSVFTQAA
LARMEAARNAVATVGAALPAFEVPRDASALNGTVNGDSVLQGVAEDA
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaaacagcgtccgcccgcgacggctgcatgtctccgcgctggccgcggtggcc
aacccgtcctacacccgcctggacacctggaacctgctcgatgacgcgtgtcgtcacctg
gcggaggtcgacctcgccgggctcgacaccacacacgacgtggctcgggcgaagcggctg
atggaccgcatcggcgcctatgagcggtactggctgtatccgggggcacagaatctggcg
actttccgcgctcatctggatagtcattccacggtgcggcttaccgaggaagtgtcgttg
gccgtacgactgctgtccgaatacggcgaccgcacagcgctgttcgacacctccgcgtca
ctggcggagcaggagctggtagcgcaggccaaacagcagcagttctacaccgtgctgctc
gccgacgactccccggcgacggctccggacagcttggccgagtgcctgcggcagttgcgc
aatccggccgacgaggtgcagttcgagttgctcgtggtggccagcatcgaagatgccatc
accgcggtggcgctgaatggcgagattcaggcggcgatcatccgtcacgacctgccgctg
cggtcccgcgaccgggtgccgctgatgaccacgctgctgggcaccgatggcgacgaagcg
gtggcaaacgagacccacgactgggtggaatgcgccgagtggatccgtgagttgcggccc
cacatcgacctctatctgctcaccgacgagtcgatcgccgccgagacccaggacgagccc
gacgtctacgaccgcaccttctaccggctcaacgacgtcaccgacctgcacagcacggtg
ctcgcgggtttacgaaaccgttatgccacaccgtttttcgatgcgctgcgggcctatgcg
gcggcgccggtcggccaatttcatgcccttcccgtcgcgcgcggcgccagcatcttcaac
tccaagtcactgcacgacatgggcgagttctacggccgcaacatcttcatggccgagacc
tcgacaacctctggtggactggactcgctgctggacccgcatggcaacatcaagacggcg
atggacaaagccgcggtgacctggaacgccaaccagacctacttcgtcaccaacggaaca
tcgaccgccaacaagatcgtcgtgcaggccctgacccgccccggcgacatcgtgctcatc
gaccgcaattgccacaagtcgcaccactacggcctggtacttgccggcgcgtacccgatg
tacctcgacgcatatccgctgccgcagtacgcgatttatggtgccgtgccgttgcgcacc
atcaagcaggcgctgctggacctcgaggccgccggacagctgcaccgggtgcgcatgctg
ttgctcaccaactgcacgtttgacggcgtggtgtacaacccgcgccgggtgatggaggag
gtgctagcgatcaaaccggacatctgctttttgtgggacgaggcgtggtatgcgtttgcg
acggcggtgccctgggcccggcagcggaccgcgatgattgctgccgagcgactcgagcag
atgttgtccactgcggaatacgctgaggaataccggaattggtgtgcgtcgatggacgga
gtggaccgctccgagtgggttgatcaccggctgttgccagaccccaaccgcgctcgggtc
cgagtgtatgcgacgcattcgactcacaagtcgctgtccgcgctacggcaggcatcgatg
atccacgtgcgcgaccaggatttcaaagcgctcacccgggacgcgttcggtgaggcattc
ttgacccacacctcgacctcgcccaaccagcaacttctcgcctcgttggacttggcgcgc
cgacaggttgacatcgaagggttcgagctggtccgccatgtttacaacatggcgctggtg
ttccgccatcgcgtccgcaaagaccggctgatcagcaagtggttccgcatccttgacgag
tccgacctggttcccgatgcctttcggtcctcgacggtcagctcgtaccgtcaggtcagg
cagggggctctggccgattggaacgaagcctggcggtccgatcaattcgtgctcgatccg
acgcggctcaccctgtttatcggggcgaccgggatgaacgggtacgacttccgcgagaag
atcctgatggagcgattcggcatccagatcaacaaaacgtctatcaacagcgtgttgctg
atcttcacgatcggcgtcacctggtcgagcgtgcactatctgctcgatgtgttgcgtcgg
gtggcgatcgatctggaccgcagccagaaggcggccagcggggccgaccttgctctacac
cgacgccacgtcgaggagatcacgcaggatctgccgcatctaccagatttcagcgagttc
gaccttgccttccgccccgacgacgccagctctttcggtgacatgcggtcggctttctac
gccggctacgaagaggccgaccgtgagtacgtgcagatcggcttggccgggcgccggctg
gctgagggcaagactctggtatccaccacgttcgtggtgccctacccgcccggcttcccg
gtactggtgccgggtcaactggtttccaaggagatcatctactttcttgcccagctcgac
gtcaaagagatccacggatacaaccccgacctggggttgtcggtgttcacccaggcggca
ttggcccggatggaggccgcgcgcaacgccgtcgccacggtaggtgccgcgctgccggcc
ttcgaggtaccgcgggacgcttcggctttgaatggcaccgtcaacggcgacagtgtgctg
cagggggtcgccgaagacgcgtga

DBGET integrated database retrieval system