KEGG   Mycobacterium tuberculosis H37Rv: Rv3809cHelp
Entry
Rv3809c           CDS       T00015                                 

Gene name
glf
Definition
(RefSeq) UDP-galactopyranose mutase
  KO
K01854  
UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rv3809c (glf)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv3809c (glf)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     Rv3809c (glf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4272276..4273475)
Genome map
AA seq 399 aa AA seqDB search
MQPMTARFDLFVVGSGFFGLTIAERVATQLDKRVLVLERRPHIGGNAYSEAEPQTGIEVH
KYGAHLFHTSNKRVWDYVRQFTDFTDYRHRVFAMHNGQAYQFPMGLGLVSQFFGKYFTPE
QARQLIAEQAAEIDTADAQNLEEKAISLIGRPLYEAFVKGYTAKQWQTDPKELPAANITR
LPVRYTFDNRYFSDTYEGLPTDGYTAWLQNMAADHRIEVRLNTDWFDVRGQLRPGSPAAP
VVYTGPLDRYFDYAEGRLGWRTLDFEVEVLPIGDFQGTAVMNYNDLDVPYTRIHEFRHFH
PERDYPTDKTVIMREYSRFAEDDDEPYYPINTEADRALLATYRARAKSETASSKVLFGGR
LGTYQYLDMHMAIASALNMYDNVLAPHLRDGVPLLQDGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgatgaccgctcgttttgaccttttcgtcgtcggctcaggattcttcggcctg
acgattgccgagcgcgtggccacccaactcgacaagcgcgtgctcgtcctcgagcggcgc
ccgcacatcgggggcaatgcctattccgaagccgagccacagaccggcatcgaggtccac
aagtacggtgcgcacctgtttcacacctctaataagagagtgtgggactacgtgcggcag
ttcaccgacttcaccgactaccggcaccgggtcttcgcgatgcacaacgggcaggcatat
cagtttccgatggggctcggcctggtatcgcagttcttcggcaagtacttcacgcccgag
caagcccgccagctgatcgccgagcaggccgccgagatcgacaccgccgacgcgcagaac
ctcgaggagaaggccatctcgctgatcggccggccgctctacgaagcgttcgtcaagggg
tacacggccaagcaatggcagactgaccccaaagaacttccggccgccaacatcacgcgg
cttcccgtgcgctacaccttcgacaaccggtatttcagcgatacttacgagggtttgccg
accgacgggtacacggcgtggttgcaaaacatggccgctgaccaccgcatcgaggtcagg
ctgaacaccgactggttcgacgtgcgcggccagctgcgccccggcagcccggcggccccg
gtcgtttacaccggcccgctggaccgctacttcgactacgccgaaggccgattgggctgg
cgcaccttggacttcgaggtggaagtgctaccgatcggggactttcagggcaccgcggtg
atgaactacaacgatctcgacgtcccctacacgcgcatccacgagttccgccacttccac
cccgagcgtgactacccaacggacaaaacggtgatcatgcgggaatactcccggttcgcc
gaggacgacgacgagccatactatccgatcaacaccgaggctgaccgcgccctgttggcc
acctatcgggccagggcgaagtccgagaccgcgtcatcgaaggtactgttcggcggccgg
ttgggcacctaccaatatctggatatgcatatggccattgccagcgccttgaacatgtac
gacaacgtcctcgcgccgcatctgcgcgacggcgtcccactgcttcaggacggcgcatga

DBGET integrated database retrieval system