KEGG   Musa acuminata (wild Malaysian banana): 103972079Help
Entry
103972079         CDS       T03447                                 

Gene name
INV-V
Definition
(RefSeq) beta-fructofuranosidase 1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103972079 (INV-V)
   00500 Starch and sucrose metabolism
    103972079 (INV-V)
Enzymes [BR:mus01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103972079 (INV-V)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 645 aa AA seqDB search
MAADSCAYPPLLHPDHPAATPTSRKKYLPVLAFAASAALILCVATFASYSSSGSRRTDLP
ENGASEPRRRISRGPAEGVSEKSSMGLLRSSPSYPWTNSMLLWQRTAFHFQPQKNWMNDP
NGPTYYRGWYHLFYQYNPASAVWGNITWGHAVSLDLVHWFYLPIAMVPDHWYDANGVWTG
SATILPDGRLAMLYTGSTAELVQVQNLAFPADQDDPLLLTWVKSESNPVLVPPPGIAPKD
FRDPTTAWYVPSESAWRIAIGSKNDSQRHAGIALVYRTSDFLSYELLPGVLHSVAGTGMW
ECVDFYPVSTESATGLDTSAATGPGVKHVLKASMDDDRNDYYAIGTYEAATNAWVPDDPE
KDVGIGLRYDYGMFYASKTFYDPVKQRRVLWGWIGETDSERTDLRKGWASLQTIPRTVLF
DQQTGSNLLQWPVDDVETLRSGSQEFSNISIPAGSVVPLDVGTATQVDIVAEFGVNKSAL
AGAVDAAVGYNCSTSGGAAGRGVLGPFGLLVLADDDLSEQTAVYFYFVRSTDGSISTHFC
HDELRSSEAADIVKRVYGSLVPVLDGETLSVRILVDHSVIESFAQGGRTCITSRVYPTSA
TYGGGRLFLFNNATGVDVTAKSLKIWQMGSAFIRPFSEHDSVSLH
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgattcttgcgcatatccccctcttctccaccctgaccatcccgccgcgact
ccgacatcaaggaagaaatacttaccggtgctcgcgtttgccgcctcggcggcgctgatt
ctgtgcgtcgccacattcgcgtcctacagctcgagtggctctcgccggaccgatttacct
gaaaatggagcgtcggaaccgaggcgacgaatctccagaggccccgccgagggcgtgtcg
gagaaatcctccatggggctcctccgctcctcgccgtcctacccctggaccaactccatg
ctcctttggcagcgcactgccttccatttccaacctcagaagaattggatgaatgatccc
aatgggccgacgtactacaggggatggtaccacctgttctaccaatacaatccggcctca
gcggtgtggggcaacattacgtgggggcacgctgtatcgctcgatctcgtgcactggttc
tatcttcccatcgccatggttcctgaccattggtacgacgccaacggcgtctggaccggc
tctgccaccatcctccccgacggccgcctcgccatgctctacaccgggtcgaccgccgag
ttggtgcaggtgcagaatctcgccttcccggccgaccaggatgacccgctcctgctaacg
tgggtcaaatccgagtcaaacccggtgctggttcccccaccggggatcgccccaaaggac
ttccgcgaccccaccacggcctggtacgtcccctccgagtcggcctggcgcatagccatc
gggtcgaagaacgactcgcagcgccacgccgggatcgctctggtgtaccggacgtccgac
ttcctgagctacgagctcctccccggcgtgctccactcggtggccgggaccgggatgtgg
gagtgcgtggacttctacccggtgtcgaccgagtcagcgacggggctggacacgtcggcg
gcgacggggccgggggtgaagcacgtgctgaaggcgagcatggacgacgacaggaacgac
tactacgccatcggcacttacgaggcggccaccaacgcgtgggtgccggacgaccccgag
aaggacgtggggatcggcctgcggtacgactacggcatgttctacgcgtccaagacgttc
tacgacccggtgaagcaacgccgagtcctgtgggggtggatcggggagaccgacagcgag
cgcaccgatctccggaagggctgggcctcccttcagaccattccgaggacggttctcttc
gaccagcagacaggaagcaacctcctacagtggccggtggacgacgtggagacgctgagg
tcgggcagccaagagttcagtaacatcagcatccccgccggctccgtcgttcccttggac
gtcggcacggccacgcaggtggacatcgtggccgagttcggggtcaacaagtcggccttg
gccggcgcggtcgacgccgcggtggggtacaactgtagcacgagcggcggcgccgccgga
aggggcgtgctcggcccgttcggcctgctcgtgctggccgacgacgatctatcggagcag
actgctgtttatttctacttcgtgagaagcactgatggcagcatcagcactcacttctgc
catgacgagctcaggtcatccgaggcagctgacatcgtcaagagggtgtatggaagcttg
gttccggtgcttgatggtgaaaccttatcagtacgcatactagtggatcactctgtcata
gagagctttgcacaaggaggcaggacatgcatcacatcacgtgtatacccaaccagcgca
acctacggcgggggacggctcttcctcttcaacaacgccaccggagtcgatgtcacggcc
aagtcgcttaagatctggcagatgggttccgcgttcattcggccgttctctgagcacgac
tcagtttcactccactga

DBGET integrated database retrieval system