KEGG   Myxococcus xanthus: MXAN_1357Help
Entry
MXAN_1357         CDS       T00366                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00330  Arginine and proline metabolism
mxa01100  Metabolic pathways
mxa01130  Biosynthesis of antibiotics
mxa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MXAN_1357 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MXAN_1357 (proB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MXAN_1357 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABF87554
UniProt: Q1DCK9
Position
1592712..1593845
Genome map
AA seq 377 aa AA seqDB search
MSSISTGRTALRSARRVVVKIGTNALTNATGRFNRQHFDALGQDLLWAAQGRELVVVSSG
AIALGVERLGLPSRPRDIPGKQACAAVGQSRLVQAYEEAFAAHGKAVAQVLLTHEDVQER
RRYLNVKHTLERLLTAGVVPVINENDTVSVDELKFGDNDTLAGLVAGVVDADALVLLSDV
EGLYTGDPRRDAGAELLATVMQVTPEVLALATGTSSGVGTGGMSTKVRAAARASDSGIHC
VITSGAVPGRLRAVLEGADVGTHFEPTGSRRSARAAWIAHALRARGTLTVDAGAREAIVT
GKRSLLPSGVRGVEGDFGRGDPVDLVDAEGAVFARGLAAYDANELRRIAGHRTADIEAVL
GYRYLDEAVHRDDLAVL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgatttccacgggacgcaccgccctacgctccgcccggcgggtggtggtgaaa
atcggcaccaacgcgctgacgaacgccaccggacgtttcaaccgtcagcacttcgatgcg
ctgggccaggatttgttgtgggccgcgcagggccgcgagctggtggtggtgtccagcggg
gccattgccctgggggtcgagcggctgggcctgccctcgcgccctcgcgacatcccgggc
aagcaggcgtgcgcggcggtggggcagagccggctggtgcaggcctacgaagaggccttc
gccgcgcatgggaaggcggtggcccaggtgctgctcacccacgaggacgtgcaggagcgc
cgccgctacctcaacgtgaagcacaccctggagcggttgctgacggcgggcgtcgtcccc
gtcatcaacgagaacgacaccgtctccgtggacgagctgaagttcggtgacaacgacacg
ctggcggggctggtggccggcgtggtggatgccgacgcgctcgtcctgctgtcggatgtg
gagggcctctacaccggagacccccggcgcgacgcaggcgcggagctgctggccacggtg
atgcaggtgacgcccgaggtcctggcgctcgccaccggtacgagcagcggggtggggacg
ggcgggatgagcaccaaggtgcgggcggccgcgcgcgcgtccgattccggcattcactgc
gtgattacgtccggcgccgtgcccggccgcctgcgcgccgtcctggaaggcgcggacgtg
gggacccacttcgaacccaccggcagccgccgcagtgcccgcgccgcgtggattgcccat
gccctgcgcgcacgcgggacgctcacggtggatgccggcgcgcgcgaggccattgtcacc
ggcaagcgcagcctgctgcccagcggcgttcgcggcgtggagggggacttcgggcgcgga
gacccggtggacctggtggacgcggagggggccgtgttcgcgcgggggctggcggcctac
gacgccaacgagctgcgacgcatcgccggacatcgcacggcggacatcgaagcggtgctg
ggctaccgctacctcgacgaggccgtgcaccgcgacgacctggccgtgctgtag

DBGET integrated database retrieval system