KEGG   Maylandia zebra (zebra mbuna): 101466835Help
Entry
101466835         CDS       T02814                                 

Definition
histone acetyltransferase KAT6B-like
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101466835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2140 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKRQKQRPSEERICHAVATSHGLDKKTVLEQLELSVHDGSI
LKVTNKGSASYKDPGHPGRVGSILPANAPVPSKESIWNSSDLRHIDWNKMLRRAIEGLDD
THGSSLKNIERYLRNQDDLSDIVDNPAFRQRLRLAAKRAVNTGRLSKNGPRYKLSHGSVE
GRSSRCPSASTLVLSSVTLLPHERDQLRVDPIPICSFCLGTKESNRDKRPEELLSCADCG
SSGHPSCLKFSTELTSNVKRLRWQCIECKTCSSCRIQGKNADEMLFCDSCDRGFHMECCD
PPLSRMPKGTWICQVCRPKENGKKLLHKKADQIKRRYAKPIGRPRNKLKQRMSVTSGDGS
MVALGGRGSPGRGQKITVCSTPSSGHAASVKDARDRFAVADPCCAVDATQFTTSTPSTTP
LLTPTSTPATLTVNKKIKGLIDGLSKFFTPSPVGRHMRAVAIESPAKQLSSREKGPPKLS
KPPELFAFAADASQKITPSSSALPPASTLPGLSPPSQVSSSSTSANSPQSSSSQSSVPSL
SSLCNSSQLKGLFDGLSHIFTTQGQSRKKRLPSYAPPKPLPHKQYSPHTSKTGPQRLGKS
EFNKNRLDSTTAGPGRPRGHPFKMVSHFKRNPFFKKRRTLGRLRYKGSPQKGALSPGKGD
LTDGRIKPENNHGHNGELHVKQETQADFAAMSRDHVTEEDIETFTRIQELAAQRTGSRSS
LMNTDSVRCPAVIEFGKYEIQTWYSSPYPPEYSRLQKLYICEFCLKYMRSKNILQRHTKK
CGWFHPPANEIYRKDNLSVFEVDGNVSKLFCQNLCLLAKLFLDHKTLYYDVEPFLFYILT
KNDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLTRQEGQAGSP
EKPLSDLGRLSYLAYWKSVILEHLYKHPDKHISVKGISRATGMCPHDIAATLQQLGMIDR
QDGRIVLIRRERLIQRHMEKLRANPRQIEVDPDALRWTPSTTLNAVLSEEEREAEMDAER
LKEQASCWEKEEREGYMMTHSSRQPLTKVHCKVPYRTYERRPAPPWTRRIQLTEEVSDEE
ADDDDDDSDGSPPILTKAHAMLAAKRKRTLVLKKRGRKRKRINSSVTTETISETTEVLNE
PFDNSEDERPMPLLERTFRVGEMDEEDEEEAHKDKTPAAPIKRRRGRPRLEKNVQKDNLE
HWNEGADLLSKRPSKPRPVKRKKGWPKGVKRGPPKWKLKNERKMGFKLNLYTPPETPMEA
EQHHIHTEEAKDGPHQDGVHVDEGSKAGRGSASPNIMLDRFPSEPPSPADHGSHKSSSPE
ASPVASLVCSPAASPGAVSPRQVDAADSPEPPEDDQQEVQHEQKSPAKDVVHSTEGAVSL
ENENEENEEGEQRAQIEDQDADDEDDRHSKTAGPENNTEDLEESSKDLPKCMPTFLDAKE
DNDSELSQQVSTVLCSEAEPATATESIQDSAPAEPSEATPAPEAAAVTSKAAVDSDNPAD
SESEEESLHSPCPEHHLPLPPAERPILNPMLREDPPVCTEIDSETAQAVQSLTQETEREN
VFQDCVESQEPCRNLQTYAHVSQSPQITSLDDCPQSDHSSPLSSAHSHPSQSVRSVNSPA
VSILDSGYTQISPDHSAISVPSLHNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTE
NYENPSSYDSTMGQNSCSYGSIPPSGLPQSSCAVSQQMAAVNPGSCGMIQQNSLSSPPHC
NVKSPQGCVVVERPPSNSQHNQHSQHSQRSQHNQHTSHSRHGPHNQHTQHNQHGPHNQLT
QHTQHNPHNQHSHHHNHHLQHNQLSQHNPHAQHSLHNQHGQHSQQQSMTQCAIPTNFATT
MQLADIPESGNPNFTLYERINHQGEYGSGHYSQSSGLSLAKLQQFTNTFIEHPHSLPFNH
SASHPITSYANTPSLSSQHSSLVSLSQTPHRVPNPQVQATVTPSPNLSSPPPMMLQRNMG
IPHSQRIQPQMASKNHISARSKSASLSHHQQQMYPRPPQAVAMQAPSRTLTAMPRMNMSM
NIMPAPAYNVNSMNMPSLNAMNGYSMSQPMMNSGYHGNHAYMNQSPQYSMQMGMMGTQPY
PQQPMQAPPHGNMVYTPAGHHGYMDTGISKQSLKGPFIRR
NT seq 6423 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaaccctctttacactgagtggattcttgaagcaatacagaaaatc
aaaaggcaaaagcagaggccctcagaggagagaatttgccatgcggtggcaacgtcacat
ggactggacaagaagaccgtccttgagcagttggaattaagtgttcatgatggctctatc
ctcaaggttacaaataaaggaagcgcctcctacaaggacccaggacatcccggaagagtt
ggatcaatcttgcctgcaaatgcacctgtgccatcaaaggaatctatatggaattcgagc
gatctgcgccatattgattggaataaaatgcttaggagggccatcgaaggcctggatgat
acccatggctcctcgctaaagaacatcgagaggtatctgaggaaccaggatgacctctca
gacattgttgataaccccgctttccggcagaggttgcggctggctgctaagcgagcagtt
aacactggcaggttgtcaaaaaatggtccgaggtataagctcagccatggaagcgtagag
ggaaggagctccaggtgtccaagtgcttccaccttggtcctgtcatctgtgacactcctc
ccccacgagcgagaccagctccgggtcgaccccatcccaatatgcagtttctgtctcgga
acgaaagagtcaaatcgggacaagcggccagaagagctgctgtcctgtgcagactgtggg
agcagtggacatccatcatgtctgaagttttccactgaattaacctcaaatgtgaagaga
ttacggtggcagtgtattgaatgcaaaacctgcagctcctgtcgaatacaggggaaaaac
gctgatgagatgctgttctgcgattcatgtgatcggggctttcacatggaatgctgcgat
ccgccgctttcaagaatgccaaaaggaacctggatctgccaagtctgcaggccgaaggag
aacgggaagaaactgctgcacaagaaagccgatcagatcaaacgtcgatatgcaaagcca
atcggaaggcccagaaataagctcaaacaaagaatgtctgtaaccagtggtgacggctcc
atggtagcactgggaggaagggggtcacctggtaggggtcaaaagattaccgtctgttcc
acaccttcatctggtcatgctgcatctgtgaaggacgcccgagacagatttgctgttgca
gacccttgttgtgcggtcgacgccacccaattcaccacttccactccctccaccactccc
ctcctcacgcccacctccaccccagctacactcactgttaacaagaaaattaaagggctt
atcgatgggctttcgaaattctttactccttcccccgtgggccgtcacatgcgagctgta
gccatagagtcgcccgccaaacagttaagctctagagaaaagggtccacccaaactgtcc
aagccaccagagctgtttgcctttgctgctgatgcctctcaaaagataaccccctcatcc
tctgcacttcctcctgcttccacattgcccggacttagccccccctcgcaggtgtccagc
agctccacttctgctaactctccccagagctcttccagccagtctagtgttccttccctg
agtagtctctgcaatagcagccaacttaagggactttttgacggactctctcacattttt
actactcagggacagtcacggaaaaagcgactaccttcctatgcgccacctaagcccctg
ccccataagcagtactccccccatacgtccaaaacggggccccagcgccttggaaagagc
gagtttaataaaaataggttagactccacaactgctgggccaggccgacccagaggacac
ccgtttaagatggtcagtcatttcaaacgtaaccctttctttaaaaagcgcaggacacta
ggcaggctgaggtataaagggagccctcagaagggagccctctcaccaggaaagggagac
ttgactgacggaagaattaagcctgagaataatcatggccacaacggggagctgcacgtg
aagcaggagacccaggcagactttgcggccatgtccagagaccacgtcacagaggaggac
atcgagaccttcacacgaatccaggaactcgctgctcagagaaccggatctcgttcatca
ctgatgaacacagactccgttcgatgccccgctgtcattgaatttgggaagtatgagatc
cagacctggtactcatcaccttacccacctgaatattcaagattacaaaagctttatata
tgcgagttctgtctgaagtacatgagaagcaaaaacatcctccagagacacacaaagaag
tgtggctggttccacccgccagccaatgaaatctacagaaaggacaacctctctgtattt
gaggttgatggaaatgtcagcaaactattctgccaaaacctctgcctgttagccaagctt
ttcctggatcacaagaccttgtattatgatgtggagcctttcctcttctacatacttaca
aagaatgatgagaaaggctgtcatcttgtgggctatttctccaaggaaaagctttgccag
cagaagtacaatgtctcctgcataatgatcatgcctcagtaccaaaggcaaggatttgga
aggttccttattgatttcagttaccttctcaccaggcaagaaggacaagctggatcccca
gagaagccgctgtcagatctgggtcgcttatcctacctggcatattggaaaagtgtcata
ctggagcacctttataagcacccagataaacacatcagtgttaaaggaataagcagggcc
actgggatgtgtccacatgacatcgccgctactctccagcagcttggcatgattgacaga
caggatggcaggatcgtgctgatcagaagggaacgactgattcagcgacacatggagaag
ctcagggcgaacccacgtcagatcgaggtggatccagacgccctgcgttggacaccttcc
accactctgaacgctgtcctgtctgaggaggagagggaagcagagatggatgctgagcgg
ctgaaggagcaggccagttgctgggagaaggaggagagagagggctacatgatgactcac
agtagtaggcaacctctcacgaaggtccactgtaaggttccctacaggacctacgaacga
aggcccgcaccgccctggaccaggcgcatccagctgactgaggaagtgagcgatgaggaa
gctgacgacgatgacgacgactcagatggctcaccacccatcttgacaaaagcccatgca
atgcttgcagccaagagaaagagaaccctggttctgaagaagagagggcgtaaaagaaag
cggataaacagcagcgtaacgacagaaaccatctcagagacgacagaggtgctgaacgag
ccattcgacaactcggaggatgagcgtcccatgccccttctggagcgcacttttagagtc
ggtgagatggatgaagaagatgaggaggaggcacacaaggacaagacaccagctgcaccg
ataaaacgacgaagaggtcgcccaaggctggagaaaaatgtgcaaaaagacaatctcgaa
cactggaatgaaggagctgatcttctctctaagagacccagcaaaccccgtccagtgaaa
cggaagaaaggctggcccaaaggagtgaaacgtggacctcctaaatggaagctaaagaac
gaaagaaagatgggctttaagctgaacctctacacaccccctgaaactccaatggaggca
gagcagcaccacattcatactgaggaagcaaaggatgggccgcaccaggatggcgtccat
gtcgatgagggcagcaaggcaggcagaggctcggcaagtcccaatataatgctggacagg
ttcccctctgagcccccaagtcctgctgaccatggctcccacaagtcgagctctccagaa
gcatcaccggtagcttctctggtgtgctccccagctgcctctcctggcgcagtgtcccca
aggcaagttgatgcagctgattcaccagaaccacctgaagatgaccagcaggaggtccaa
catgagcagaaatccccagccaaagatgtagtgcacagcacagagggtgctgtatcgcta
gagaatgagaatgaggaaaatgaggagggcgagcaaagagcccaaatagaggatcaggat
gcagatgatgaagatgaccgccacagcaagacagcagggccagagaataatacagaagac
ctggaagagagttcaaaagacttacccaaatgcatgccaacttttttagatgcaaaagaa
gacaatgactctgagttgagtcagcaggtttctacagtactctgtagtgaagcggaacca
gctactgctacagaaagcatccaggatagtgcgccggcagaaccatcagaagcaacaccg
gcacctgaagcagcagcagtcacttcaaaagcagctgtagactctgataatcctgcagac
tctgagtcagaggaagagagtttgcatagtccttgtccagaacaccacctgcctcttccg
cctgcagagaggccaatactcaatcccatgctgagggaggatcccccagtctgcacagag
attgactcagagacagcccaagctgttcagtccctgacgcaggagaccgagcgggagaat
gttttccaggactgcgtggagagccaggagccctgcaggaacctgcaaacgtatgcccat
gtgagccagagcccccagatcacctcgctggacgactgtcctcagtcagatcacagcagc
cccctttcctctgcgcactcccatcccagccaatcagtacgctcagttaacagcccagct
gtctccatcctggacagtggctacacgcagatcagccctgaccacagtgccatctcagtg
ccgtcgctccataatatggagacaagtcccatgatggatgtaccgtcggtgtcggatcac
tcgcagcaggtggtggacagtggcttcagcgatctgggcagcattgagagtacgacagag
aactacgagaaccccagcagctacgactccaccatgggccagaacagctgctcatacggc
agcatcccccctagcggcctgccccagagcagctgcgccgtgagccaacaaatggctgcc
gttaaccccggcagctgcgggatgatccagcagaacagcctgagctcaccgccgcactgc
aacgtcaagtcaccgcagggctgcgtcgtggttgagaggcctccgagcaacagccagcac
aaccagcacagtcaacacagccagcgcagccaacacaatcaacacacctcccacagcagg
cacggcccacacaatcagcacacccaacacaatcagcacggtccacacaatcagcttacc
cagcacactcaacacaatccccacaaccagcatagccaccaccacaatcatcacctgcag
cacaatcagctcagccagcacaatccgcatgctcagcatagccttcacaatcagcacggt
cagcacagccagcagcagtctatgactcagtgcgccatacccaccaatttcgccaccacc
atgcagctggcagacatccctgaatctggcaacccaaactttaccctctatgagaggatc
aaccaccagggggagtatggcagcgggcactattctcagtcctctggccttagtctcgcc
aaattgcaacaatttaccaacacattcatagagcaccctcactcgctgcctttcaaccac
tcggcctcacaccccatcacatcatacgccaacaccccctcattatcatcacagcactct
agcctggtatccttgtcccagacgccacatcgagtccccaacccacaggtgcaggccacc
gtgaccccgtccccgaatctcagctcaccgccacccatgatgctacagcgcaacatgggc
atcccgcactcgcagcggatccagcctcagatggcctccaaaaatcacatctctgcacgc
tccaagtcggcctcgctgtcgcaccaccagcagcagatgtacccccggccgccacaggct
gtcgccatgcaggcgccatccaggacgctgaccgccatgccacgcatgaacatgagcatg
aacatcatgccggcaccagcctacaacgtcaactccatgaacatgccctccctcaacgcc
atgaacggctacagcatgagccagcccatgatgaacagtggctaccatggcaaccatgcc
tatatgaaccagtcaccccagtactctatgcagatgggcatgatgggaacacagccatac
ccccagcagcccatgcaggctccaccacatggcaacatggtgtacactccagctgggcac
catggctacatggacacaggcatatccaagcagtccctgaaagggcctttcatcaggcgg
taa

DBGET integrated database retrieval system