KEGG   Maylandia zebra (zebra mbuna): 101481317Help
Entry
101481317         CDS       T02814                                 

Definition
NAD-dependent protein deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
Enzymes [BR:mze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101481317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MSVNYAAGLTPYANKGVCGLPEHFDNPEELKAKVETLAQLIKESQYLVVHSGAGISTSAG
IPDFRGPKGVWTLEEKGESPHFDTTFEDARPSFTHMALLGLQRAGYLKYLISQNVDGLHV
RSGFPRDLLSELHGNMFVEECEKCGRQYVREKVIGVMGLKPTGRYCEVVRSRGLRACRGK
LISTILDWEDALPDRDLNKADDASRRADLALTLGTSLQIKPSGDLPLLTKRKGGKLVIVN
LQPTKHDKHAHLRIHGYVDDVMKQLMELLGLEIPKWDGPTVCESSTATTETTADVKPPRG
VTAKEKVEKNFVKEERKREASQLTDDGSVKEETVSVKRERADLPVEINEEK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaattatgcagctggactcacgccgtacgcaaacaaaggtgtctgcggactt
cctgagcactttgataatcctgaggagctgaaggccaaggtggaaactctagctcagctg
attaaagaatctcagtacttggttgtccactcgggagctgggatcagcacctcggcaggt
atccccgacttcaggggtcccaagggtgtgtggactcttgaagaaaagggtgagtcacct
cattttgatactacatttgaagatgctcgcccaagcttcactcacatggctctcctggga
ctgcagagggcagggtacctcaaatatctcatcagccagaatgtggatggcctgcatgtg
cgatcaggcttccccagggatttgttatcagagcttcatgggaacatgtttgtggaggag
tgtgagaagtgtggcaggcagtacgtccgagaaaaggtgatcggtgtgatgggcctgaaa
ccgacaggacgctactgtgaggtggtacgatccagggggctcagagcgtgcagagggaag
ctgatcagcactatacttgactgggaggatgctcttcctgacagagacctgaacaaagca
gatgacgcaagcagacgagcggacctggctctgactctgggcacgtccctgcagatcaaa
cccagtggagacctcccactcctcaccaagcgcaagggtggcaaactggttattgtcaac
ctgcagccgaccaaacacgacaagcatgcacacctgcgtatccatggttatgtggacgac
gtcatgaaacagctgatggagctgctgggactggaaatcccaaagtgggatggaccaact
gtctgcgagagctccacagctaccactgagaccaccgccgatgtcaaaccaccgcgtgga
gttactgcgaaggaaaaggtggaaaagaactttgttaaggaggagaggaaaagagaagct
tcacagctaacggacgatggaagcgttaaggaggagacagtttcagtaaagagggagaga
gcggacctcccagtggagataaatgaagagaaatag

DBGET integrated database retrieval system