KEGG   Methanosalsum zhilinae: Mzhil_2015Help
Entry
Mzhil_2015        CDS       T01541                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mzhil_2015
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_2015
   00020 Citrate cycle (TCA cycle)
    Mzhil_2015
   00620 Pyruvate metabolism
    Mzhil_2015
   00640 Propanoate metabolism
    Mzhil_2015
   00650 Butanoate metabolism
    Mzhil_2015
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_2015
   00680 Methane metabolism
    Mzhil_2015
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mzhil_2015
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mzhil_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2125007..2126221
Genome map
AA seq 404 aa AA seqDB search
MAVLRETDKDKMTVVEGSYAVAHAVKICRPNVISAYPITPQTHIVEELSQFMADGEIPNC
EYMNVESEFSALSALVGSAATGARTYSATTSQGLALMHEVMFNAAGMRLPIVMTIVNRAM
SAPINIWNDQQDSISQRDTGWIQLYAEDIQEASDMIAQAYRVSEDKDVLLPAMVCMDGFI
LSHVYEPVVLLEQDLTDKYLKKYETELKLDPKNPLSFGAFADPSTYTEFRYLQQQAMDIA
LERIEEAADEFRDIYGRYYGGLVDEYMTEDADIILFAMGSVVGTVRDVVDEMRNRGEKVG
LLKIRTFRPFPAEAIKKAIANSKVVVTLDKNITIGLNEGALFTETKSCLYNTDIRIPVIG
FTLGHGGRDIPEKTIENIIDTAKKTMESGIDSESQFIDVREDLI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctgtattacgcgaaacagataaagataagatgaccgttgttgaagggtcatatgca
gttgcacatgctgtcaaaatatgcagaccaaatgtcatttcagcatatcccataactccg
cagacacacatagttgaggaattatcccagtttatggcagatggagagatcccaaactgt
gaatatatgaatgtagaatcagaattttccgcactctcagcacttgttggttcagctgca
accggagccaggacatattcggccacaacatctcagggccttgcactcatgcatgaggtt
atgttcaatgctgcaggtatgagacttccaattgtcatgacaatcgttaacagggcaatg
agcgctccaatcaatatctggaatgatcagcaggactcaatatcccagagagataccgga
tggatccagttatatgctgaggatatacaggaagcatctgacatgatcgcacaggcgtac
agggtttctgaagataaggatgtactgcttcctgcaatggtatgtatggatgggttcata
ctatcccatgtatatgagccagttgtactgctcgaacaggatcttacagacaaataccta
aaaaaatacgaaacagagctcaaacttgatccaaagaatccattaagttttggagctttt
gctgatccttcaacctatacagaattcagatacctgcagcagcaggcaatggatatagcc
cttgaaaggattgaagaagccgctgatgagttcagggatatctacggtagatattatggt
ggtcttgtagatgagtacatgacagaagatgcagatataatcctctttgcaatgggatca
gtggttggtactgtaagagatgtggtggacgagatgcgaaaccgcggtgaaaaggtgggt
cttctcaagatccgtactttcagaccattccctgcagaagccatcaaaaaagccattgcc
aattcaaaggtggttgtcacacttgataagaacatcaccatcggacttaacgaaggagca
ctctttacagaaacaaaatcatgcctgtacaacacagatatcagaattcctgtaattggg
ttcacactggggcatggaggaagagatatacctgaaaaaacgattgaaaatataatagat
acagcaaagaaaacaatggaatccggaatagattccgagagccagttcattgatgttagg
gaggatttgatatga

DBGET integrated database retrieval system