KEGG   Methanosalsum zhilinae: Mzhil_2016Help
Entry
Mzhil_2016        CDS       T01541                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mzhil_2016
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_2016
   00020 Citrate cycle (TCA cycle)
    Mzhil_2016
   00620 Pyruvate metabolism
    Mzhil_2016
   00640 Propanoate metabolism
    Mzhil_2016
   00650 Butanoate metabolism
    Mzhil_2016
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_2016
   00680 Methane metabolism
    Mzhil_2016
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mzhil_2016
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mzhil_2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2126218..2127093
Genome map
AA seq 291 aa AA seqDB search
MKELLSPGHTACPACCDTMIAKFTLRALGEDCIIVSPTGCLEVTTSAFPTSSWQVPWIHS
LFENAGAVASGIEAALKAMDKKEDTKVVVLAGDGGTLDIGMRSISGAFERGHDIVYICID
NEAYMNTGVQRSGATPFNATTTTSPSGKVSFGNPLPKKNMPAIMAAHGSPYVATTTLAYP
KDLMKKVKKAADIEGPTYIHAHAPCTTGWGFDTAKTVEIGKLAVQTALWPMYEMENGEIT
SVKKIKKPKPVEDYLRMQRRFKHLFTMEGGAEEIEKIQAIADYNIKHFGLQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgttaagcccgggacatactgcatgtcctgcatgctgcgatacaatgata
gcaaagtttactttaagggcccttggggaggattgtatcattgtaagtccaacaggttgc
cttgaagtaaccaccagtgccttccccacaagttcctggcaggtaccatggatacactcc
cttttcgaaaatgcaggtgcagtggcatctggaatagaagctgctctaaaggcaatggac
aaaaaagaagacactaaggttgttgtgcttgcaggtgatggaggtacactggatattgga
atgaggagtatctcaggtgcctttgaaagaggacatgatatagtatacatatgtattgat
aatgaagcatacatgaacaccggtgtccagagaagcggagctacgccatttaatgcaact
accacaaccagtccttcaggaaaagtatcttttggtaatcccttaccaaagaagaacatg
ccagcaattatggctgcacacggatccccctatgttgcaacaacaacccttgcatatcca
aaagatctaatgaaaaaagtcaaaaaggcagccgatattgaagggcctacatatatccat
gcccatgcaccatgtacgaccggatggggctttgatactgcaaagaccgtagaaattgga
aaactggctgtccagacagcactctggcctatgtatgaaatggagaatggtgagatcaca
tccgttaaaaagatcaaaaagccaaaacctgttgaagattatctcaggatgcagcgccgg
ttcaaacatcttttcaccatggaaggtggagcagaagagatcgagaagattcaggcaatt
gcagattataacatcaaacatttcgggttgcagtaa

DBGET integrated database retrieval system