KEGG   Nocardiopsis alba: B005_3584Help
Entry
B005_3584         CDS       T02218                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nal  Nocardiopsis alba
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B005_3584 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B005_3584 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    B005_3584 (aceB)
Enzymes [BR:nal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B005_3584 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3762186..3763790)
Genome map
AA seq 534 aa AA seqDB search
MGATHGVEITGPLNDRFDEILTDDALAFIAELHRAFESRRQELLAARKTREAQIAAGEDL
DFLPETKHIREDDGWKVAPPAPGITDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIQGQLNLRDALDRAIDFTSPQGKTYALKEDSELATIVVRPRGWHLDEKHILVDG
RRTSGGIVDFALYFFHSAKRQIAKGKGPYFYLPKMQSHLEARLWNDIFVLAQERLEIPRG
TIRATCLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKTHRTRGRKFLLPERNA
VTMTAPMMRAYTELLVKTCHKRGAHAIGGMAAFIPSRRDEEVNRNAFAKVRDDKSRESGD
GFDGSWVAHPDLVPIAREIFDGVLGDRPNQIDKQRPEVEVTAADLLAVDKTPGGITLAGL
RGNINVALQYLAVWMGGNGAVAIHNLMEDAATAEISRSQIWQWLHNDVTLDDGPKVTVEL
VKQTIEEELAAIKASLGDAYDEDLYKQAKELFTEVALDDDYVDFLTLPAYERMP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacgcacggggtcgagatcacgggccccctcaacgaccggttcgacgagatc
ctcaccgacgacgccctcgcgttcatcgccgaactgcaccgcgctttcgagtcccgccgc
caggagctgctggccgcgcgtaagacccgcgaggctcagatcgcggccggggaggacctc
gacttcctccccgagaccaagcacattcgcgaggacgacggctggaaggtcgctccgccc
gccccgggcatcacggaccgccgtgtggagatcaccggcccgaccgaccgcaaaatgacc
atcaacgcgctcaactccggcgcgaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatccaggggcagctcaacctgcgcgacgccctggaccgcgcc
atcgacttcacctccccccagggcaagacctacgccctcaaggaggactccgagctcgcc
acgatcgtcgtgcgcccgcgcggctggcacctggacgagaagcacatcctcgtcgacggt
cggcggaccagcggcggcatcgtcgacttcgcgctgtacttcttccacagcgccaagcgt
cagatcgccaagggcaagggcccgtacttctacctgccgaagatgcagagccacctcgag
gcccgtctctggaacgacatcttcgtcctggcccaggagcgtctggagatcccccgcggc
accatccgcgccacctgcctgatcgagaccatcccggccgcgttcgagatggaggagatc
ctctacgagctgcgcgagcactccgccggcctcaacgccggtcgctgggactacctcttc
agcatcatcaagacgcaccgcacccgcggccgcaagttcctgctgcccgagcgcaacgcc
gtcaccatgaccgccccgatgatgcgcgcctacaccgagctgctggtcaagacctgccac
aagcgcggcgcccacgccatcggcggtatggccgccttcatcccctcccgccgggacgag
gaggtcaaccggaacgccttcgccaaggtccgtgacgacaagtcccgcgagtccggcgac
ggcttcgacggctcctgggtcgcgcaccccgacctggtcccgatcgcccgtgagatcttc
gacggcgtcctgggcgacaggcccaaccagatcgacaagcagcgccccgaggtcgaggtg
accgccgccgacctgctcgccgtcgacaagacccccggcgggatcaccctcgccggcctg
cgcggcaacatcaacgtcgccctgcagtacctggccgtgtggatgggcggcaacggcgcg
gtggccatccacaacctcatggaggacgccgccaccgccgagatctcccgctcccagatc
tggcagtggctgcacaacgacgtcaccctcgacgacggccccaaggtcaccgtcgagctg
gtcaagcagaccatcgaggaggagctggccgccatcaaggcctcgctgggcgacgcctac
gacgaggacctgtacaagcaggccaaggagctgttcaccgaggtcgccctggacgacgac
tacgtcgacttcctgacgctgccggcctacgagcgcatgccgtag

DBGET integrated database retrieval system