KEGG   'Nostoc azollae' 0708: Aazo_2511Help
Entry
Aazo_2511         CDS       T01260                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00260  Glycine, serine and threonine metabolism
naz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01130  Biosynthesis of antibiotics
naz01230  Biosynthesis of amino acids
Module
naz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aazo_2511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aazo_2511
Enzymes [BR:naz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aazo_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI64410
JGI: Aazo_2511
UniProt: D7DYT1
Position
complement(2618469..2619710)
Genome map
AA seq 413 aa AA seqDB search
MTTTPLFRNLPQTASVPDILGRFGPFGGKYVPETLMPALAELETAYQQYRNEPSFQAELQ
GLLRDYVGRATPLYFAERLTAYYARPDGTGAQIYLKREDLNHTGAHKINNAIGQVLLAKR
MGKQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLMAAEVRPVS
AGTGTLKDATSEAIRDWVTNVESTHYILGSVAGPHPYPMMVRDFHAVIGEETRAQAQEKW
GGLPDILMACVGGGSNAMGLFHEFVKEPYVQLIGVEAAGEGVNTGKHAATLTKGQVGVLH
GAMSYLLQDDDGQVIEPHSISAGLDYPGVGPEHSYMKDIGRAEYYSVTDAEALEAFQRLS
KLEGIIPALETAHAIAYLETLCPQVSGSPRIIINCSGRGDKDVQTVAKFLTPQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgactactacaccccttttccgcaacttgccacaaactgcttcagttcccgatatcttg
ggacgctttggcccctttggtggtaaatatgttcctgaaactttgatgcctgctttagct
gaactggaaacagcgtatcagcaataccgcaatgaacctagttttcaggcagaattacaa
ggtttgctgcgagattacgtaggacgtgcgacacctttatactttgctgaacgtcttaca
gcctattatgctcgtcctgatggcacaggagcgcaaatttacttaaaacgtgaagattta
aatcatactggggctcataaaattaataatgccattggtcaagtattgttggcaaagcgc
atgggtaaacagcggattattgccgaaactggtgcaggacaacatggtgtagcgacggcg
acggtttgcgctcgtttcgggttggaatgtgtaatttatatgggtgttcacgatatggaa
cgccaagctttaaatgtatttagaatgcggctgatggcggctgaagttcgtcctgtgtct
gcgggtacgggaactctcaaagatgcgacttctgaagctatccgcgactgggtgacaaat
gtggaaagcacccactacattctgggttctgtagctggaccccatccttacccaatgatg
gtacgtgattttcatgcggttattggtgaagaaactcgcgctcaagctcaggaaaaatgg
ggcggtttacctgatattctgatggcttgtgtgggtggtggttctaatgctatgggacta
tttcacgagtttgttaaagagccatatgtgcagttaattggtgtggaagctgctggtgaa
ggtgtgaatactggcaaacacgcggctactttgacaaaaggacaagttggtgtattacat
ggcgcgatgagttatctgttgcaagatgatgacggacaagtaattgagccacactcgatt
agtgcaggtttggattatcctggtgtgggtccagaacacagctatatgaaggatattggc
cgggctgaatattatagtgtgacagatgctgaggctttggaggcatttcaacgcctatcg
aagctagaaggaattataccagcattggaaactgctcatgcgatcgcttatttagaaact
ttgtgtcctcaagttagtggtagtcctcgtattattattaactgttctggacgaggtgat
aaggatgtgcaaacagtagcaaaatttttaactcctcagtaa

DBGET integrated database retrieval system