KEGG   Nocardioides sp. JS614: Noca_0116Help
Entry
Noca_0116         CDS       T00443                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
nca  Nocardioides sp. JS614
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Noca_0116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Noca_0116
   00520 Amino sugar and nucleotide sugar metabolism
    Noca_0116
Enzymes [BR:nca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Noca_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(129996..130754)
Genome map
AA seq 252 aa AA seqDB search
MAQTAPQPFGIDFGGTGIKGAPVDLEAGDFAAERVRIRTPDPSTPERVAAVFVELLRRFP
DSTGAVGVTVPGVVRHGVVRSAANIDRAWVGTDADRLFTRATGREVHVVNDADGAGLAEV
RYGAAKGRSGLVIVTTLGTGIGSAMVYDGVLVPNSELGHLEVEGHDAESRAANSARERED
LSWEQWAKRLTTYYRTLERLFSPELFVVGGGVSKSSAEFLALVDIDTEIIPAALLNKAGV
VGAALYASEGGG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacggcaccgcagcccttcggcatcgacttcggtggcaccggcatcaagggc
gcaccggtcgacctcgaggccggcgacttcgccgccgagcgggtccggatccggaccccc
gacccgtccacacccgagcgggtggcggcggtcttcgtcgagctgctgcgccgattcccg
gactccaccggcgcggtcggcgtgacggtccccggggtggtccgccacggcgtggtccgc
tcggcggccaacatcgacagggcctgggtcggcaccgacgccgaccggctcttcacccgg
gccaccggccgcgaggtgcacgtcgtgaacgacgcggacggcgccgggctggccgaggtg
cggtacggcgcggcgaagggccgctccggcctggtgatcgtgaccaccctcggcaccggg
atcggctcggcgatggtctacgacggcgtcctggtgccgaactccgagctcggccacctc
gaggtcgagggccacgacgccgagtcccgggcggccaacagcgcccgcgagcgcgaggac
ctgtcctgggagcagtgggcgaagcggctcacgacgtactaccgcaccctggagcggctc
ttctctcccgagctgttcgtggtcggcggcggggtcagcaagtcctccgccgagttcctc
gcgctggtggacatcgacaccgagatcatcccggcggcgctgctcaacaaggccggggtg
gtgggcgcggcgctctacgcctccgagggtggcggctga

DBGET integrated database retrieval system