KEGG   Nosema ceranae: NCER_101104Help
Entry
NCER_101104       CDS       T01614                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nce  Nosema ceranae
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nce00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCER_101104
Enzymes [BR:nce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NCER_101104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 179 aa AA seqDB search
MYVIFTGPSGSGKTSIIRYLVKNYNLLLSVSYTTRQKREGEVDGIDYFFISKQEFSNKID
NNELEEYTYFNGNFYGTPKNDIENLILDLEYEGVTYFHYNKKDCILIYIDVDIQILVDRL
VSRGTDEQELRNRMDKYSKYEELKKIIPFDFIVDNNGEFNSSVKILVDFLKNKNIIYCL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtaatattcacaggtccaagtggatcgggaaaaacttctattattaggtatctt
gtaaagaattacaatcttttattaagtgtatcgtatactactaggcagaaaagagaaggg
gaagtagatggcattgattatttttttatttctaaacaagaatttagtaataaaattgac
aataatgaattagaagaatatacatattttaacggtaatttttatggtacacctaagaat
gatatagaaaacttaatattagatttagaatatgaaggtgttacttattttcattataac
aaaaaagattgtattcttatttatattgatgttgatatacaaatactagttgatagatta
gttagtagaggaacagatgaacaagaattacgaaatagaatggataaatattctaaatat
gaagaattaaaaaaaattataccttttgattttattgttgataataatggagagtttaat
tcttcagtaaaaattttagtagattttttaaaaaataaaaatattatttattgtttgtaa

DBGET integrated database retrieval system