KEGG   Neurospora crassa: NCU01754Help
Entry
NCU01754          CDS       T01034                                 

Gene name
adh-1
Definition
(RefSeq) alcohol dehydrogenase-1
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncr  Neurospora crassa
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCU01754 (adh-1)
  Lipid metabolism
   00071 Fatty acid degradation
    NCU01754 (adh-1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCU01754 (adh-1)
Enzymes [BR:ncr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCU01754 (adh-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Linkage Group II; II
AA seq 353 aa AA seqDB search
MPQFEIPEQQWAQVVEKKGGPVVFKQIPVQKPGPDEVLINVKYSGVCHTDLHAMKGDWPL
ATKMPLVGGHEGAGVVVAKGELVTEVEVGDHAGIKWLNGSCLACSFCMQADEPLCPHALL
SGYTVDGSFQQYAIAKAAHVAKIPKGCDLETTAPVLCAGITVYKGLKESGVRPGQCVAIV
GAGGGLGSMAIQYANAMGLHAIAIDGGEEKGKNCRELGAQAYVDFTTTKDLVADVKAATP
DGLGPHAVILLAVSEKPFHQAVDYVRSRGTIICIGLPAGAKFQAPVFDTVIRMITIKGSY
VGNRQDTQEALDFFARGLIKVPIKTVGLSKLQEVYDLMEEGKIVGRYVVDTSK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagttcgagattccagaacagcaatgggcccaggtggtcgagaagaagggcggt
cccgtcgtcttcaagcagatccccgttcagaagcccggccccgatgaggtccttatcaac
gtcaagtactctggcgtctgccataccgatctccatgccatgaagggtgactggcccctc
gctaccaagatgcctctggtcggcggccacgaaggcgccggtgtcgtcgtagccaagggt
gagctcgttactgaggttgaggttggcgaccacgccggtatcaagtggctcaacggctcc
tgcctggcctgctcattctgcatgcaggccgacgagcctctgtgccctcacgccctcctg
tccggctacactgtcgacggttccttccagcaatacgctatcgccaaggccgcccacgtc
gccaagatccccaaggggtgcgacctcgagaccaccgcgcccgtcctctgcgccggtatc
accgtctacaagggtctcaaggagtccggtgttcgtcccggccagtgcgtcgccatcgtc
ggcgccggcggtggtctcggcagcatggccattcagtacgccaacgccatgggcctgcac
gccatcgccattgacggtggcgaggagaagggcaagaactgccgcgagctgggcgcccag
gcctacgtcgacttcactactaccaaagaccttgtcgcggacgtcaaggctgccaccccc
gacggcctcggtccccacgccgtcatccttctcgccgtgtccgagaagccgttccaccaa
gccgtcgattacgtccgttcccgcggaaccatcatctgcatcggtctccccgctggcgcc
aagttccaggcccccgttttcgacaccgtcatccgcatgatcaccatcaagggctcgtat
gtcggtaacaggcaggatacccaggaggcccttgacttctttgcccgcggcttgatcaag
gttcccatcaagacggtcggcctcagcaaattgcaggaagtctacgacttgatggaggag
ggcaagattgtcggcagatatgtcgtcgataccagcaaatag

DBGET integrated database retrieval system