KEGG   Neurospora crassa: NCU07024Help
Entry
NCU07024          CDS       T01034                                 

Definition
mitogen-activated protein kinase sty1
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ncr  Neurospora crassa
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ncr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    NCU07024
Enzymes [BR:ncr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     NCU07024
Protein kinases [BR:ncr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   NCU07024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV
AA seq 358 aa AA seqDB search
MAEFIRAQIFGTTFEITSRYSDLQPVGMGAFGLVCSAKDQLTNQNVAIKKIMKPFSTPVL
AKRTYRELKLLKHLRHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEKQFIQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMLEGKPLFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPKRERQPLKNKFKNADSSAVDLLERMLVFDPKKRITATEALSHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEASGQMMFQEDVPPQ
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggccgaatttatccgcgcccagatcttcggaactacctttgagatcacctcgaggtat
tccgatctccagcctgttggcatgggagcctttggtcttgtctgctccgcgaaagaccag
ctcaccaaccagaatgtcgccatcaagaagattatgaagcccttcagcacaccggtcctt
gccaaacgcacgtaccgtgagctgaagcttctcaagcacttgaggcacgaaaacgtcatc
tctctgagcgatatcttcatctctcctctcgaggatatctactttgttaccgagcttctc
ggaaccgatcttcacagacttcttacgtccaggcctcttgagaagcagtttatccagtac
ttcctgtaccagattatgcgcggtctcaaatacgttcactccgccggtgttgtccaccgt
gacctgaagccaagtaacatcctggtcaacgagaattgcgacttgaagatttgcgatttc
ggccttgcgcgtatccaggatcctcagatgacgggctacgtttctactcgttactaccgc
gcccccgagatcatgctcacttggcaaaagtacgacgtcgaggtcgatatctggagtgcc
ggctgcattttcgccgagatgctggagggcaagcccctcttccctggcaaggaccatgtc
aaccagttctccatcatcaccgagcttctcggcactcccccagacgatgtcatcaacacg
attgctagcgagaacaccctgagattcgtcaagtcccttcccaagcgcgagcgtcagccc
ctgaagaataagttcaagaacgccgattcatcagccgtcgatctgctcgagcgcatgctt
gtctttgaccctaagaagcggataactgccaccgaggccctttcacacgagtaccttgct
ccttaccacgaccccaccgacgagccggttgccgaggagaagttcgattggagtttcaat
gatgctgatctcccggtcgacacatggaagatcatgatgtactccgagatcctggactat
cacaacgtcgaagcctcggggcaaatgatgttccaggaagatgttccgccgcaataa

DBGET integrated database retrieval system