KEGG   Naumovozyma castellii: NCAS_0B01500Help
Entry
NCAS_0B01500      CDS       T02233                                 

Gene name
NCAS0B01500
Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ncs  Naumovozyma castellii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCAS_0B01500 (NCAS0B01500)
   00670 One carbon pool by folate
    NCAS_0B01500 (NCAS0B01500)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NCAS_0B01500 (NCAS0B01500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:246019..246666
Genome map
AA seq 215 aa AA seqDB search
MSLAKSKTKLPVVSIVACLVPEMGIGFQGNLPWRLSKEMKYFRQVTSSTFDPAKKNAVIM
GRKTWESIPARFRPLPNRINVVISRSFTDTLQEANDLTDPYFKINSLSGCIDELTTKMTK
DLERIYIIGGGEIYNECYNMADYWLITKLTPVDTVEPEMDTFLNTKTLKQVFEEDKTHLS
EFLPEGVELPEKSEDGCYHAQEKGYSFEFTFYNKR
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtccctagcaaagtccaaaacgaaattaccagtagtgagcattgtagcatgtcttgtt
ccagaaatggggattgggtttcaaggaaatttaccctggagactctccaaagaaatgaaa
tactttagacaagtgacatcgtccacttttgaccctgcaaagaaaaatgcagtaattatg
ggtagaaaaacctgggaatcaattccagccagatttagaccgctacctaaccgtatcaat
gttgtgatttctcgtagtttcacagatactttgcaagaagctaatgatctgactgatcct
tattttaagatcaattctctttcaggttgcattgatgaattaaccaccaagatgactaaa
gatctggaaaggatatatattattggtggaggagagatttataacgaatgttataatatg
gctgactactggttgattacaaaacttactccggtggatacagttgaacctgaaatggat
acatttttaaatacaaagacgttgaaacaagtatttgaagaagataaaacccatttgtca
gagtttcttcctgaaggtgtcgaattaccagaaaaaagtgaagatggctgttaccatgcc
caggaaaaaggttacagttttgagtttacgttttataataaaagataa

DBGET integrated database retrieval system