KEGG   Naumovozyma castellii: NCAS_0D02510Help
Entry
NCAS_0D02510      CDS       T02233                                 

Gene name
NCAS0D02510
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ncs  Naumovozyma castellii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NCAS_0D02510 (NCAS0D02510)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NCAS_0D02510 (NCAS0D02510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(474974..476914)
Genome map
AA seq 646 aa AA seqDB search
MAQLPLLPSITNYTTSTFSTTSSSVSSSTSSVSSASTETSISSACISISSALSKKSSSKR
AEKSKKKKSSSSKKKHQKKEDPISSAILTEDGIKIRAKTSSSTSNSNSSTPNPYSLSNST
SNVNSTLTINTSTTSFRSSTDSHLETASLISCVTCLSDNPANDSQGSNNNSHTTTSVNGQ
LPDNVVIPYGRILNAKYIDPIKKNNLIEIVFAKPRRHDVIPKKLTVSIENQYLNGDLLDE
IMDRSYKNTKRNRSILVVINPFGGKRKAKKVFMSKAKPLLLASECSIDIAYTEYIGHGIK
IAQELDIDKYDTIACASGDGIPHEIMNGLYRRPDRVKAFNKLAITQIPCGSGNAMSVSCH
WTNNPSYATLCLIKSIEVRVDVMLCSQPSYVDQFPKLSFLSQTYGVIAESDINTESFRWM
GSARFELGVAFNILQRKKYPCDIYVKYAAKSKNELKSRYLKHKTRESLRFQDELEEQQQG
QLYGVIDGEAGYVPDPGSVTEEDFHIKYPFHEGVPNDWEKVDSNITDNLGIFYTGKMPYV
AADTKFFPAALPCDGAIDMVITDSRTPFTRMAPILLALDRGSHVLQPEVIHSKILAYKLV
PKLTNGLIAVDGEKFPLEPIQVEIMPRLCKTLLRNGVFVDTDFDSM
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactaccattactcccgtcaataacaaattatacaacttccacattctcaaca
acttcaagttctgtttcttcatcaacgtccagtgtatcatccgcatccactgaaacatca
atatcatctgcatgtatctctatctcatctgcattatcaaagaaatcttcaagtaaaaga
gctgagaagagtaaaaagaaaaaatcatcatcatcaaagaagaaacatcaaaaaaaggaa
gatcccatctcatctgccatactcacagaagatggtatcaaaattagagcaaagacatcc
tcttccacttccaattcaaattcatcaactccaaatccatattcattatcaaatagtaca
agtaatgtgaatagtacacttaccatcaatacaagtaccacaagttttagaagtagtacg
gattctcatttggaaacagcttcacttataagctgcgttacctgtttaagtgataatcct
gctaatgattctcaaggtagcaataataatagtcatacaacaacatcggtcaatggacaa
ttaccagataatgttgttataccgtatggtagaatattaaatgccaaatatattgaccct
atcaagaagaataatttaatagaaattgtatttgccaaaccaagaagacatgacgttatc
ccaaaaaaattaacagtatccattgaaaatcaatatttaaatggtgatctgttagatgaa
attatggatagaagttataaaaatacgaaaaggaatagatccattctcgtagtaataaac
ccatttggtggtaagaggaaagctaaaaaggtattcatgagtaaggcaaaaccattattg
ttagcaagtgaatgttccattgatatagcatatactgaatatattggacatggtatcaaa
attgcacaagaattggatattgacaaatatgataccattgcatgtgcctcaggagatggc
atcccacacgaaattatgaacggattatatagacgccctgatcgtgtcaaagcctttaat
aaattagcaataacacaaattccatgtgggtccggtaatgccatgagtgtttcttgtcat
tggacaaataatccatcatatgcaactttatgtttaattaaatccattgaagttcgtgtg
gatgtcatgttatgttctcaaccttcatatgtggaccaatttcctaaattatcattctta
agtcaaacttatggtgtcattgcagaatcagatataaatacagaatcatttagatggatg
ggttctgcacgtttcgaattaggtgtagcattcaatattttacaacgcaagaaatatcca
tgtgacatctatgtgaaatatgctgctaaatccaaaaatgaattaaaatcaaggtatttg
aaacataagacgagggaatccctaagatttcaagatgaattggaagaacaacaacaaggt
caattatatggtgtcattgatggagaagcaggttatgttcctgatccaggatcagtgaca
gaagaagattttcatataaaatatccattccatgagggtgttcctaatgattgggaaaaa
gtagattcaaatataactgataatttgggtatattttatacggggaaaatgccatatgtg
gctgctgatacaaaatttttcccagcagctttaccatgtgatggtgccatagatatggtc
ataacagattctcgcactccatttactagaatggctcccatcttattagcattagataga
ggttctcatgtcttacaaccagaggtaattcattccaagattctagcttacaagttggta
ccaaaattaacaaatggtttaatagctgtggatggagagaaatttcccctagaacctatt
caagtggaaatcatgcccagattgtgcaagacattattaaggaatggtgtctttgttgat
acagattttgattcaatgtag

DBGET integrated database retrieval system