KEGG   Nitrosomonas europaea: NE1859Help
Entry
NE1859            CDS       T00130                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
neu  Nitrosomonas europaea
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:neu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:neu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2009107..2010183)
Genome map
AA seq 358 aa AA seqDB search
MKKISVLIIDDSALIRKLLTEIINARPDMEVIGAAPDPIVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTERGSEVTFRALELGAVDFVAKPKMDIRNSLEAYT
DEITGKIRTASTARIHRLEPVASNGAASGSIVQMPRHHGISTEKLIIIGASTGGTEAIKD
VLIHLPPDCPGILITQHMPEGFTRSFAERLDRLCKIRVKEAEGGERVLPGHAYLAPGHSH
LLLKKSGANYVTELSQTDPVNRHRPSVDVLFQSAAHCAGKNAVGVILTGMGKDGAAGMLD
MHHAGAYNLAQDETSCVVFGMPKEAITLGAVDEIVPLQDMARRILARLVGAGKQAVRV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatcagtgtacttatcattgatgattcagccctgattcgcaaattactgacc
gagatcatcaatgcccggccggatatggaggtgattggtgcggccccggatccgatagtg
gcgcgtgaaatgatccggacattgaatccggatgtactgacgctggatgtggaaatgcca
aagatggatggcctggaatttctggagaaactgatgcgattgcggcccatgccggtggtg
atggtatcgacactgactgagcggggatcagaagtaacctttcgggcgctggaactgggg
gccgttgattttgttgccaaaccaaagatggatatccgcaatagcctcgaagcctacaca
gatgaaattacaggaaaaattcgtactgccagcacggcacgtatccatcgtctggaaccc
gttgccagcaatggtgctgcaagtggaagtattgtacagatgccgcggcatcacggtatt
tctaccgaaaagctgatcatcattggggcatctactggcggtaccgaggccatcaaagat
gtgctgattcatttgccgccggattgtccgggtatactgattactcagcatatgccggaa
gggtttacccgttcctttgccgagcggctcgaccggttatgcaaaatccgggtcaaggag
gccgaaggaggcgagcgggtgctgccgggtcatgcatatctcgcaccgggtcattcccat
ctcctgctgaagaaaagcggtgctaactatgtgaccgaattgagtcaaacagatccggtc
aaccgccaccgcccatcagtggatgtactgtttcagtctgcggcccattgcgccgggaaa
aatgctgtcggcgtgattctgacggggatgggcaaggatggtgccgcgggaatgctcgat
atgcatcatgcaggtgcctataatctggcgcaggatgaaaccagttgcgtggtgtttggt
atgcccaaagaagctattacccttggcgctgtcgatgaaatcgtcccgttgcaggatatg
gccagacgaatattggcgagactggtcggcgcaggtaaacaggctgtccgtgtatga

DBGET integrated database retrieval system