KEGG   Neosartorya fischeri: NFIA_047960Help
Entry
NFIA_047960       CDS       T01070                                 

Definition
endoglucanase, putative
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_047960
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NFIA_047960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MDSKRGIVAAVLALLSVVSAQQPATSSAGNPKLTTYKCTTAGGCVAQDTSVVLDWGSHWI
HTVNGYTSCTTSSGVDSTLCPDEATCAKNCVIEPANYTSAGVATSGDSLTMYQYVQNNGV
YTNASPRLYLLGPDKDYVMLKLLGQELSFDVDLSTLPCGENGALYLSEMSASGGRNEYNT
GGAEYGSGYCDAQCPVIAWKNGTLNTSGASYCCNEMDILEANSRANSYTPHPCSATDCDK
GGCGFNPYALGQKSYWGPGGTVDTSKPFTITTQFITNDGTTTGTLSEIRRQYIQNGKVIA
NAVSSAGVSSITEDWCTSVDSSAATFGGLTTMGKALGRGMVLIFSIWNDASGFMNWLDSG
NSGPCSSTEGNPDLIKAQNPTTHVVFSNIRWGDIGSTFKGSDDSGTTTTKTTTTKTSTST
TSTKTTTSTAPGATQTHYGQCGGQGWTGPTACASPYTCKAQNQWYSQCL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggactccaaaagaggcattgtggccgctgtgctggccttgctttctgtcgtttctgcg
caacaacccgccacaagttctgctggtaaccccaagcttacaacatacaaatgtaccact
gccggcggctgtgttgcgcaagatacatctgttgttcttgattggggctcccactggatc
cacacggtcaatgggtatacatcatgcaccacatcgtccggagtcgacagtaccctgtgt
cctgatgaggccacctgcgcgaagaactgtgtgatcgagccggccaactacaccagcgcc
ggtgtggccacctcgggtgactctctgactatgtaccaatatgttcagaacaacggcgtc
tacaccaacgcctcgcctcgcctctacctcctcggcccagacaaggactatgtcatgctg
aagctgctaggccaggagctctccttcgacgtggacctgtccacactcccctgcggcgaa
aacggtgccctgtatctctccgaaatgagcgccagcggtggtcgcaacgaatacaacacc
ggaggcgccgagtacggctctggctactgtgacgcgcaatgccccgtgattgcctggaag
aacggcaccctcaacacgagcggcgcaagctactgctgcaacgagatggacatcctcgag
gccaactcccgcgccaactcgtacaccccgcacccctgcagcgcaacggactgtgacaag
ggcggatgcggcttcaacccatacgctctaggccagaagagctactgggggcccggcggc
accgtcgacacttctaagcccttcaccatcaccacgcagttcatcaccaacgacggcacc
accaccggcactttgtccgaaatccgcagacagtacatccagaacggcaaggtgatcgcc
aacgccgtttcctccgctggcgtcagctccattaccgaggactggtgcacgtccgtcgac
agctcggccgccacctttggcggactgaccaccatgggcaaggcgctgggccgcgggatg
gtcctcatcttcagcatctggaacgatgccagcggcttcatgaactggctcgacagcggc
aattcaggcccttgcagcagcaccgaggggaacccggacctgatcaaggcgcagaatccc
acgacccacgtggtcttctctaatatccgctggggagatatcggatcgactttcaagggt
tctgatgactcgggtacgacgaccactaagaccacaactaccaagacgtccacgtccacc
acgtcaaccaagactaccactagcactgcgcccggggcgacgcaaactcactatggacag
tgcggtggacagggctggactggacccacggcttgtgcatcgccctacacttgcaaggct
cagaatcagtggtactcacagtgtctgtag

DBGET integrated database retrieval system