KEGG   Neosartorya fischeri: NFIA_076670Help
Entry
NFIA_076670       CDS       T01070                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_076670
Enzymes [BR:nfi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NFIA_076670
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NFIA_076670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 714 aa AA seqDB search
MASTEASNIAQSAPPDGTGVIQLDPWLEPFRDALRHRFGLVENWIKTINENEGGLDKFSK
GYEKFGFNVNANGDITYREWAPNAVRAYLVGDFNNWDVTAHPMTKDGFGVWEVTVPSKDG
VPAIPHDSKVKIAMDIPSGERIYRIPAWIKRVVQDLEVSPIYESVFWNPPESERYKFKHS
RPKKPESLRIYEAHVGISSPETRVATYKEFTKNMLPRIKYLGYNAIQLMAIMEHAYYASF
GYQVNNFFAASSRYGTPDELKELIDTAHSMGLTVLLDVVHSHASKNVDDGLNMFDGTDHL
YFHEGGKGRHDLWDSRLFNYGHHEVLRFLLSNLRFWMEEYGFDGFRFDGVTSMLYVHHGI
GTGFSGGYHEYFGPSVDDEGVMYLTLANEMLHTLYPDCITVAEDVSGMPALCLPHSLGGV
GFDYRLAMAIPDMYIKLLKEKSDSEWEMGNLAFTLTNRRHGEKTIAYAESHDQALVGDKT
LMMWLCDKEMYTHMSVLTEFTPTIERGMALHKMIRLVTHGLGGEGYLNFEGNEFGHPEWL
DFPRAGNNNSFWYARRQLNLTEDHLLRYKFLNEFDRGMQLTEEKYGWLHSPQAYVSLKHE
IDKVLAFERAGLLWIFNFHPTESFTDYRVGVEQAGTYRIVLDTDDPEFGGFGRNLKETRF
FTTDMPWNGRSNYLQVYLPTRTALVCTPSTFSPPLAIHELTEASMQVFALEETL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactgaagcttcaaacatcgctcagtcagcgcctccagatggcacaggtgtt
atccagttagatccttggcttgaacctttccgcgacgctctacgacacagattcgggttg
gtcgaaaactggatcaagacaatcaacgaaaacgagggtggtctagataagtttagcaag
ggctacgagaaatttggattcaatgtcaatgccaatggagacatcacatatcgggagtgg
gctcccaatgctgtgcgagcttacttagtcggtgatttcaacaactgggatgtaacagcg
catcccatgacaaaagacggctttggcgtgtgggaagttacggtgccctcgaaggacggc
gtgccagccatcccgcatgatagcaaggtcaagattgcgatggacattcccagcggagag
cgaatttaccggatacctgcgtggatcaagcgtgtggtccaggacctcgaagtgtccccc
atttatgagtccgtgttttggaatcctcccgagtctgaacggtacaaattcaaacattcc
cgcccgaagaaaccggagagcctccgcatctatgaggcccatgtgggtatctcatccccc
gagacccgggttgcgacatacaaagagtttacgaagaacatgctgcctcggataaagtac
ttggggtacaatgcgatccagctcatggccattatggaacatgcctactacgccagtttc
ggataccaggtcaacaacttcttcgcagcgagcagtcgttacggcacacctgacgagctg
aaggagcttatcgatacagcacacagtatgggcttgacagtgcttctcgacgttgtccac
agccatgcgtcaaaaaatgtcgatgatggactgaacatgtttgatggaacagaccacctc
tatttccatgaaggaggaaagggccgacatgacctgtgggacagtcggctgtttaactac
ggccatcacgaggtcctgcgcttccttctgagcaaccttcgtttctggatggaagaatac
ggcttcgatggcttccgtttcgacggagtcacgagtatgctttatgtacaccatggtatt
ggaaccggattttcaggcggataccacgaatactttggcccttctgttgatgacgagggt
gtgatgtacctcactcttgccaatgagatgctccatactttgtatcccgactgcatcacc
gtggcagaagacgtctccggaatgccggctctctgtttacctcactccctcggtggcgtt
gggttcgattaccgcctcgcaatggccatcccagacatgtacatcaaactcctgaaggaa
aagtccgacagtgagtgggaaatgggtaatctcgccttcaccctgaccaatagacgtcac
ggcgagaagacaatcgcctatgcagaaagtcatgatcaagccctggtcggcgataaaacg
ctcatgatgtggctctgcgacaaggaaatgtacacccacatgtccgtgctgaccgaattc
acccccaccatcgaacgaggcatggccctgcacaagatgatccgactggtcacccacggc
ctgggaggagagggctacctcaacttcgaaggcaacgagttcggccacccagaatggctc
gatttcccccgtgccggaaacaacaattccttctggtatgcccgccgccaactcaacctc
accgaagaccatctcctccgctacaagttcctcaacgagttcgaccgcggcatgcagttg
accgaggagaagtacggctggctgcactctccacaagcctacgtgagcctcaagcacgag
atcgacaaggtcctcgccttcgagcgcgcaggtctgctctggatcttcaacttccacccc
acagaaagcttcaccgactaccgtgtcggtgtcgagcaagcaggtacctaccgcatcgtc
ctggacacggatgatccggaatttggtggcttcggccgcaatctcaaggagacccgcttc
ttcaccaccgatatgccctggaacggccgtagtaattacctgcaggtctatcttcctacc
cgaacagcgctggtatgtactccatccaccttttcccctccgttggcgattcacgagcta
acagaagcttcaatgcaggtcttcgccctggaagaaacactgtag

DBGET integrated database retrieval system