KEGG   Neisseria gonorrhoeae NCCP11945: NGK_2360Help
Entry
NGK_2360          CDS       T00728                                 

Definition
dTDP-6-deoxy-L-mannose-dehydrogenase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ngk  Neisseria gonorrhoeae NCCP11945
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ngk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NGK_2360
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NGK_2360
Enzymes [BR:ngk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NGK_2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1964605..1965162)
Genome map
AA seq 185 aa AA seqDB search
MDIIDTALPDVKLLKPQVFTDGRGFFMETFRDGWFKENIADRTFVQENHSNSSKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNRYQLWIPEGFAHGFC
VLGDAAEVVYKCTDYYNPETEQVLIWNDPAIGIGWPLQTAPLLSPKDLAGKTWAQAEKLR
LTLSR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggacatcatcgacaccgccctccccgacgtaaaacttttaaaaccgcaagtcttcaca
gacgggcgcggtttttttatggaaacattccgcgacggatggttcaaagaaaatattgcc
gatcgaactttcgtgcaggaaaaccactccaactccagcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacccaaggcaaactcgtacgcgtagttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatgggcgggcgcaacc
ttgtcggcgcaaaaccgataccagctttggatacccgaaggcttcgcacacggtttttgc
gttttgggcgacgcggcggaagtcgtgtacaaatgcacggactattacaaccctgaaacc
gaacaggttttaatatggaacgacccggcaatcggcataggctggccgcttcaaaccgcg
ccgctgctttcgcccaaagaccttgccggcaaaacgtgggcacaagccgaaaagctccgc
cttacgctttcccgataa

DBGET integrated database retrieval system