KEGG   Nitrobacter hamburgensis: Nham_3565Help
Entry
Nham_3565         CDS       T00348                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nha  Nitrobacter hamburgensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:nha01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nha00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:nha00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3923332..3925515
Genome map
AA seq 727 aa AA seqDB search
MTRIDAHGLKIAPVLFDFIAREATPRTGIAPDAFWAGLAAIVRDLGPRNRELLAVRDTLQ
AQIDGWHRANKSRPFDMAAYTAFLKEIGYLLPEPATHAVETANIDDEIGKICGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAIAHEANEARGYDKARGDKVIAKAKAFLDSAAPLS
AGSHADVAGYSVVNGHLSAKLRSGDATGLKTIAQFAGYQGAADAPSAILLVNHGLHIDIR
IDRADRIGKDDPAGVADVIIEAAISTILDMEDSVAAVDADDKVLVYRNTLGLMNGTLTDT
FEKGGKTVTRALNADRIYTSANGKEIALHGRSLLLMRNVGHHMVTDAVLDENGAEIPEGM
LDAAVSSLLAIHDLMGISKTRNSRTGSVYIVKPKMHGPDEVALTCELFARVETMLGLPEN
TLKIGIMDEERRTTVNLKTCIQNASKRVCFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWMRAYEDWNVDIGLIDGLPGHAQIGKGMWAAPDRMADMLAQKVDHPQAGATTAWVPSP
TAATLHALHYHQVDVLKQQQELKAGGQRAKLSDILTVPVSQSNWAPDDVRLEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQNVVTSDQVMDSLKRM
AVVVDKQNAGDPLYTPMAPTFDGVAFKAACDLVFKGREQPNGYTEYILTERRRQAKAESK
GESEAAG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcattgacgcccacggactgaagatcgcgcctgtcctgttcgattttatcgcc
cgggaggccacgccccggaccggcattgccccggatgccttttgggccgggcttgccgcc
atcgtccgcgatctcggaccgagaaaccgcgaattgctcgcggtgcgcgatacgctgcaa
gcgcagatcgacggctggcatcgcgccaacaaaagccggccgttcgacatggccgcctac
acggcgttcctgaaagagatcggctatctgctgccagagcccgcgacccatgcggtcgag
accgccaatatcgacgacgagatcggaaaaatctgcggaccgcaactggtggtgccgctg
accaatgcccgttacgcgctgaatgccgccaatgcgcgctggggcagcctctacgatgcg
ttatacggcaccgatgccattgcgcacgaggccaacgaggccaggggctatgacaaggcg
cgcggcgacaaggtgatcgccaaagccaaggcgttcctcgattccgccgcaccgctttcg
gccggcagccatgccgatgtcgccggctacagcgtcgtcaatggacacctgtcggcgaaa
ctcaggagcggcgacgccaccggcctgaagacgattgcgcaattcgcgggctatcagggc
gccgcggacgcaccgtccgcgatcctgctggtcaaccacggcctgcatatcgacatccgg
atcgaccgcgccgaccgcatcggcaaggacgatccggccggcgtcgccgatgtgatcatc
gaggccgccatcagcaccattctcgatatggaggacagcgtcgccgccgtcgatgccgac
gacaaggtgctggtgtatcgcaatacgctcggcctgatgaacggcacgctcacggacacc
ttcgagaagggcggcaagaccgtcacccgcgccctcaacgccgatcgcatctacacgtca
gccaatggcaaggagatcgccctccacggacgcagcctgcttttgatgcgcaacgtcggc
catcacatggttaccgacgcggtactggatgaaaacggcgcagagattccggaaggtatg
ctcgacgccgcggtatcaagcctgctcgcgatccacgatctcatggggatttcgaagacg
cggaacagccggacaggctcggtctacatcgtcaagccgaagatgcacggccccgacgag
gtggcgctgacctgcgaactgttcgcccgcgtcgagaccatgctcggactgccggagaac
accctcaagatcggcatcatggacgaggagcgccgcaccaccgtcaacctcaagacctgc
atccagaacgcctcgaaacgagtctgcttcatcaacaccggcttcctcgaccgcaccggc
gacgaaatccatacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccgtggatgagggcctacgaggactggaatgtcgacatcggcctgatcgacggcctg
cccggccacgcccagatcggcaagggcatgtgggccgcgcccgaccggatggccgacatg
ctcgcgcagaaggtcgaccacccgcaagccggcgccaccaccgcatgggtgccctcgccg
accgcggcaacgctgcacgccctgcactatcatcaggtcgacgtgctgaagcagcaacag
gaattgaaagccggcggacagcgcgcaaagctgtcggacatcctcacggtcccggtgtcg
caatcgaactgggcgccggacgatgtgaggctggagatcgacaacaactgccagggcatt
ctcggctacgtggtgcgctggatcgatcagggcgtcggctgctcgaaggtgcccgatatc
cacgacgtcggcctgatggaagaccgcgccacgctgcgcatctccagccagcatctggcg
aactggctacatcagaacgtcgtcaccagcgatcaggtgatggactcgctgaagcgcatg
gccgtcgtcgttgacaagcagaacgccggcgatcccctctacacgccgatggcgccgaca
ttcgacggcgtcgccttcaaggcggcctgcgatctcgtgttcaagggccgcgagcagccg
aacggctataccgaatacatcctgaccgaacggcggcgccaggccaaggcggagtccaag
ggggagtccgaggcggccggctga

DBGET integrated database retrieval system