KEGG   Nitrobacter hamburgensis: Nham_3565Help
Entry
Nham_3565         CDS       T00348                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nha  Nitrobacter hamburgensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nham_3565
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nham_3565
   00630 Glyoxylate and dicarboxylate metabolism
    Nham_3565
Enzymes [BR:nha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Nham_3565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3923332..3925515
Genome map
AA seq 727 aa AA seqDB search
MTRIDAHGLKIAPVLFDFIAREATPRTGIAPDAFWAGLAAIVRDLGPRNRELLAVRDTLQ
AQIDGWHRANKSRPFDMAAYTAFLKEIGYLLPEPATHAVETANIDDEIGKICGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAIAHEANEARGYDKARGDKVIAKAKAFLDSAAPLS
AGSHADVAGYSVVNGHLSAKLRSGDATGLKTIAQFAGYQGAADAPSAILLVNHGLHIDIR
IDRADRIGKDDPAGVADVIIEAAISTILDMEDSVAAVDADDKVLVYRNTLGLMNGTLTDT
FEKGGKTVTRALNADRIYTSANGKEIALHGRSLLLMRNVGHHMVTDAVLDENGAEIPEGM
LDAAVSSLLAIHDLMGISKTRNSRTGSVYIVKPKMHGPDEVALTCELFARVETMLGLPEN
TLKIGIMDEERRTTVNLKTCIQNASKRVCFINTGFLDRTGDEIHTSMEAGPMIRKNEMKA
QPWMRAYEDWNVDIGLIDGLPGHAQIGKGMWAAPDRMADMLAQKVDHPQAGATTAWVPSP
TAATLHALHYHQVDVLKQQQELKAGGQRAKLSDILTVPVSQSNWAPDDVRLEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHQNVVTSDQVMDSLKRM
AVVVDKQNAGDPLYTPMAPTFDGVAFKAACDLVFKGREQPNGYTEYILTERRRQAKAESK
GESEAAG
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcattgacgcccacggactgaagatcgcgcctgtcctgttcgattttatcgcc
cgggaggccacgccccggaccggcattgccccggatgccttttgggccgggcttgccgcc
atcgtccgcgatctcggaccgagaaaccgcgaattgctcgcggtgcgcgatacgctgcaa
gcgcagatcgacggctggcatcgcgccaacaaaagccggccgttcgacatggccgcctac
acggcgttcctgaaagagatcggctatctgctgccagagcccgcgacccatgcggtcgag
accgccaatatcgacgacgagatcggaaaaatctgcggaccgcaactggtggtgccgctg
accaatgcccgttacgcgctgaatgccgccaatgcgcgctggggcagcctctacgatgcg
ttatacggcaccgatgccattgcgcacgaggccaacgaggccaggggctatgacaaggcg
cgcggcgacaaggtgatcgccaaagccaaggcgttcctcgattccgccgcaccgctttcg
gccggcagccatgccgatgtcgccggctacagcgtcgtcaatggacacctgtcggcgaaa
ctcaggagcggcgacgccaccggcctgaagacgattgcgcaattcgcgggctatcagggc
gccgcggacgcaccgtccgcgatcctgctggtcaaccacggcctgcatatcgacatccgg
atcgaccgcgccgaccgcatcggcaaggacgatccggccggcgtcgccgatgtgatcatc
gaggccgccatcagcaccattctcgatatggaggacagcgtcgccgccgtcgatgccgac
gacaaggtgctggtgtatcgcaatacgctcggcctgatgaacggcacgctcacggacacc
ttcgagaagggcggcaagaccgtcacccgcgccctcaacgccgatcgcatctacacgtca
gccaatggcaaggagatcgccctccacggacgcagcctgcttttgatgcgcaacgtcggc
catcacatggttaccgacgcggtactggatgaaaacggcgcagagattccggaaggtatg
ctcgacgccgcggtatcaagcctgctcgcgatccacgatctcatggggatttcgaagacg
cggaacagccggacaggctcggtctacatcgtcaagccgaagatgcacggccccgacgag
gtggcgctgacctgcgaactgttcgcccgcgtcgagaccatgctcggactgccggagaac
accctcaagatcggcatcatggacgaggagcgccgcaccaccgtcaacctcaagacctgc
atccagaacgcctcgaaacgagtctgcttcatcaacaccggcttcctcgaccgcaccggc
gacgaaatccatacctcgatggaagcgggtccgatgatccgcaagaacgagatgaaggcg
cagccgtggatgagggcctacgaggactggaatgtcgacatcggcctgatcgacggcctg
cccggccacgcccagatcggcaagggcatgtgggccgcgcccgaccggatggccgacatg
ctcgcgcagaaggtcgaccacccgcaagccggcgccaccaccgcatgggtgccctcgccg
accgcggcaacgctgcacgccctgcactatcatcaggtcgacgtgctgaagcagcaacag
gaattgaaagccggcggacagcgcgcaaagctgtcggacatcctcacggtcccggtgtcg
caatcgaactgggcgccggacgatgtgaggctggagatcgacaacaactgccagggcatt
ctcggctacgtggtgcgctggatcgatcagggcgtcggctgctcgaaggtgcccgatatc
cacgacgtcggcctgatggaagaccgcgccacgctgcgcatctccagccagcatctggcg
aactggctacatcagaacgtcgtcaccagcgatcaggtgatggactcgctgaagcgcatg
gccgtcgtcgttgacaagcagaacgccggcgatcccctctacacgccgatggcgccgaca
ttcgacggcgtcgccttcaaggcggcctgcgatctcgtgttcaagggccgcgagcagccg
aacggctataccgaatacatcctgaccgaacggcggcgccaggccaaggcggagtccaag
ggggagtccgaggcggccggctga

DBGET integrated database retrieval system