KEGG   Nectria haematococca: NECHADRAFT_34931Help
Entry
NECHADRAFT_34931  CDS       T01612                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
nhe  Nectria haematococca
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3
AA seq 2425 aa AA seqDB search
MAQAQQVALERLEYITRGLRSRSGDDVRKRSAIQLRELVVVCHRDLSPEQFLAFYNAVNN
KITHLITHGNDSSERLGGIYALDALIDFEGVDMSAKYTRFTQNLKTILRGKDINPMQPAA
IALGKLCRPGGSLISELVDSEVNTALEWLQNDRVEERRYSAVLVLRELARSAPTLMYQYI
PTIFDWIWVGLRDSRQLIRATSAETVSACFRILRERDQEMKQLWMSKIYNESKQGLKVNT
VESVHGSLLVLKELLEQGAMYMQEHYQQACDIVFKHKDHRDPTIRKTVVLLIPDLASYSP
ADFAHTWLHKFMVYLSGMLKKDKERNDAFLAIGNIANSVKSAIAPYLDGVLIYVREGLSI
QSRKRGSVDPVFDCISRLAVAVGQTLSKYMEALLDPIFACDLTPKLTQALVDMAFYIPPV
KPTIQERLLDMLSVVLCGEPFKPLGAPQPNTLNSVPIIPKDAKDPLAYEHRRAEVKLALN
TLGSFDFSGHVLNEFVRDVAIKYVEDEDPEIREAAALTCCQLYVRDPIVNQTSYHALQVV
GDVIEKLLTVGVSDPEPTIRRTVLAALDERFDRHLAKAENIRILFFALNDEVFSIREVAI
SIIGRLARYNPAYVIPSLRKTLIQMLTELEFSDVARSKEESAKLLSLLVQNAQSLIKPYV
EPMISVLLPKANDSNPSVAATILKAIGELATVGGEDMLPYKDRLMPLIIDALQDQSSNSK
REAALHALGQLASNSGYVIEPYLEYPQLLEILQSIIRTEGQRAPLRQETIKLMGILGALD
PYKHQVEERTPDARRLESNQLTDISLMMTGLTPSNKEYFPTVVINALLQILKDPSLVQHH
AAVIEAIMNIFRTLGLECVSFLDRIIPAFLHVIRSATSTRLESYFNQLATLVSIVRQHIR
NYLPDIVEILQEYWHTSPSLQTTIMSLVEAISRSLEGEFKIYLASLLPLMLGVLDKDTSA
KRTPSERVMHAFLVFGASAEEYMHLIIPVIVRTFEKQGQPTFIRKQAIDTIGKISRQVNL
NDYAAKIIHPLTRVLDMGEPQLRLAALDTLCALIQQLGKDYLHFMGTVNKTINQHQIQHP
NYELFVSKLQKGEVLPQDLSSADRFADGSEEPTFADQGTKKLEMNAIHLKAAWDTKGKST
KEDWQEWLRRFSTTLLTESPNHALRACASLASVYLPLARELFNSAFVSCWSELYEQFQDE
LIQNIESAIKSENVPPDLLGLLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHYK
ELEFLQDQSSGAVEALIVINNQLQQSDAAIGILRKAQLYKEGIQLRETWFEKLERWEEAL
AFYNKREAEVPEDQAIPVDIVMGKMRCLHALGEWEALATLTGSTWANSTPEVQRMIAPLA
TAAAWGLNKWDSMDNYLSSLKRYSPDRSFFGAILALHRNQFREAIACVQQAREGLDTELS
ALVSESYNRAYQVVVRVQMLAELEELIVYKQCDEKKQAIMRRTWETRLKGCQRNVEVWQR
MLRLRAIVIAPSENMHMWIKFANLCRKSGRMGLAEKSLKQLIGSDAPLESMIPYWNERPT
APGPRNTAAQVIYAVLKYQWELGQQPGFKLSGTAEKTLYCLRKFTNDAAHRLDIARAHLS
AQTGGDMGMATEYGFQNQMDPSLMSPQTQRALYDQTVLLAKCYLRQGEWLIALNKDDWQY
TQVQDILTSYSQATKYNPRWYKAWHAWALANFEIVQALSARNEGHLSRTDQAMVIEHVVP
AVKGFFKSIALSQGSSLQDTLRLLTLWFTHGGSADVNAAVTEGFANVSVDTWLEVIPQLI
ARINQPNKRVQQSVHNLLADVGRAHPQALVYPLTVAMKSWQNTRRSRSAAQIMDSMRQHS
ANLVAQADTVSHELIRVAVLWHELWHEGLEEASRLYFGDHNIEGMFATLEPLHELLERGP
ETLREISFAQAFGRDLKEAQDWCRQYETSQDVNDLNQAWDLYYQVFRRISRQLPQVTTLE
LTYCSPKLLNAKNLDLAVPGTYKSGQPIVRIMSFETTFSVINSKQRPRKLNINGSDGKSS
AFLLKGHEDIRQDERVMQLFGLCNTLLAHDSECYKRHLNIQRYPAIPLSQNSGLLGWVPN
SDTLHVLIREYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQDLYRV
LWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRVTGKIIHIDFGDCF
EVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRITCENVMRVLRDNKESVMAVLEAFI
HDPLLTWRLTNAASPAGPNFRSERDAPIPGAGGVRARRQSILDSDVAPSELLNAAEPSAP
PTRSRARTNSSAAQDGNPMVNGTQEVESQNARAVEVLDRVAQKLTGRDFKNNEELDVINQ
VNKLIMEATKLENLCQHYIGWCSFW
NT seq 7278 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagcacagcaggtcgctttagagcggcttgaatacatcactcgtggccttcgt
tcgaggagcggcgacgatgtgcgcaaacggtctgcgatacagcttcgggagctcgtagtt
gtctgccatcgagacctgagccctgagcaattcctcgccttctacaatgccgtcaacaac
aagattacgcatctcatcacacatggcaacgactcttccgaacgcctgggcggcatctac
gctctcgatgcgctcatcgatttcgagggtgttgatatgtccgctaaatatacgcgtttc
acacagaacttgaaaacgatcctccgaggaaaagacatcaatccgatgcagcctgccgcg
atcgccctgggaaagctttgtcgacctggtggctccttgatatctgagttggtggactcg
gaggtcaacacagcgctcgaatggctccagaacgaccgtgtagaggaacgacgatatagt
gcggtgctcgttcttcgagaactcgcccgcagcgcgccgactctgatgtatcaatacatc
ccgaccatcttcgactggatctgggttggacttagagattccagacagctcatccgtgcg
acgtcggcagagacagttagcgcctgcttccgaatcctccgcgagcgagaccaagagatg
aagcagttgtggatgagcaagatttacaatgaatcgaagcaaggactcaaggttaacaca
gtcgagtccgtccacggttcgctactcgtcctgaaggagctcctcgaacagggagccatg
tacatgcaggaacactaccagcaggcttgcgacattgttttcaagcacaaggatcatcga
gacccgaccatcagaaagactgtggtgcttctgatccccgatctggccagctattcccca
gctgactttgcccacacgtggctacacaagttcatggtttacttgtctggcatgcttaag
aaggacaaggagcgtaatgacgctttccttgccatcggtaacatcgccaactcggtcaaa
agcgcaatcgctccctacctcgacggtgtgctcatctacgtgcgcgaaggcctcagcatt
cagtctcgtaagagaggctcagtggaccccgtctttgactgcatcagcaggcttgccgtg
gctgtcggccagaccttgagcaagtacatggaagcactgctggaccccatctttgcgtgt
gacctcactcctaagctcacccaggcccttgtcgacatggccttctatatcccacccgtc
aagccgacaatccaggagagactccttgacatgctcagcgttgttctgtgtggtgaacct
ttcaagcctcttggcgcaccacagccaaacacactcaactcggtgccgattatccccaag
gacgccaaggaccccctggcttatgagcaccggagggccgaggtgaagctggcgcttaac
actctcggaagcttcgacttctccggccatgttctgaacgagtttgtccgcgacgtggcg
atcaagtatgtggaggatgaggatccggagatccgtgaagctgcggccttgacctgctgc
cagctttacgtccgtgaccccattgtcaaccagaccagttaccatgcgctacaggttgtt
ggcgatgtcatcgagaagctcttgaccgtcggagtctcggaccccgaacctaccattaga
cggaccgtcctggcggctctcgacgagcgatttgaccgacacctggccaaggcggaaaac
attcgcatcctctttttcgctctgaacgacgaggtcttttcgatccgagaggttgccatc
tccattattggtcgcctggctagatacaacccagcatatgtcatcccttcgctccgcaag
actctcattcagatgctcactgagcttgagttctccgacgtcgcccgtagcaaggaagag
agtgccaagcttctgagtctcttggttcagaatgcacagtccctgatcaagccttacgtc
gaacccatgatttcggttttgcttcccaaggcgaatgattctaacccctcagttgcggcc
accattctcaaggcgattggtgagcttgcgactgtgggcggcgaggacatgctgccatac
aaggaccgcctgatgccgctcatcatcgatgcgctgcaagatcagagctctaactcgaag
cgagaagccgctttgcatgccctgggacagttggccagcaactccggctatgtcatcgag
ccctaccttgaatatccacagctcttggagattctccagagcattatccgaaccgaggga
caacgggcgccattacggcaggagaccatcaaactgatgggtatcctgggtgccctcgat
ccatacaagcatcaggtcgaagaacgaacaccggatgcccgacgtctcgagtccaaccag
ctgacagacatttccctcatgatgacgggcttgaccccatcaaacaaggagtatttcccg
accgtcgttatcaacgcccttctgcaaatcctcaaagatccgtctctggtacagcaccac
gcagctgtgattgaagcaattatgaacatctttcgcaccctgggactggagtgtgtgtcg
tttcttgatagaatcataccggccttcctccatgtcatcaggtctgctacctccacaaga
ttggagtcctacttcaaccagttggcaactctcgttagcattgtccgacagcatatcaga
aattatctcccggacattgtcgagatcttgcaagaatactggcacacgtcaccatcactt
cagaccaccatcatgtctcttgtcgaggccatatcaaggtctcttgagggagagttcaag
atttatctggccagtctccttccgctgatgcttggcgttcttgacaaggacacctctgct
aagcgcaccccgtcggagagggtgatgcatgctttcttggtgtttggtgccagtgccgag
gagtacatgcatctcatcattcctgtgattgtgcgcacatttgagaagcagggtcagccc
accttcattcgaaagcaggctatcgacacgattggaaagatctcgcgtcaagtcaacctc
aacgactacgctgcaaagatcatccacccactgacgcgtgtgttggacatgggagagcct
cagctgcgactggctgctctggacaccctctgtgcccttattcagcagctgggcaaggat
tacctccactttatgggtaccgtcaacaagaccatcaaccagcatcagatccagcacccc
aactacgagctttttgtcagcaagctgcagaagggtgaggttttgcctcaggatctgagc
tctgccgatcgatttgccgatggatcggaggagcctacctttgctgaccaaggaacgaag
aagctggagatgaacgccattcatctcaaggccgcttgggacactaagggcaagtcgacc
aaggaagattggcaagaatggctgcgacgattcagcacaactctgctgactgaatctccg
aatcacgctctgcgagcctgtgctagtctcgcaagtgtttacctgcctctggcacgagaa
ctgttcaactcggcgtttgtgtcatgctggagcgagctgtacgaacagttccaggacgag
ctcatccagaacatcgaaagcgccatcaagtcagagaacgtcccacctgatctgcttgga
cttctgctcaaccttgccgagtttatggagcatgacgacaaggctttgccgattgacatt
cgggtgctgggtagggaggctgctcgctgtcacgcttatgcaaaggccttgcactacaag
gaactcgagttcctgcaggaccagagcagtggcgctgtcgaggccctgatcgttatcaac
aatcagcttcagcagtctgatgctgctatcggtattctccgcaaagctcaattgtataag
gaaggcattcagctgcgggagacatggttcgagaagttggagcgttgggaggaagcactg
gctttctacaacaagcgagaggcggaggtgcctgaagaccaggcaattcctgtcgacatt
gtcatgggcaagatgcgttgtttgcatgcccttggcgagtgggaagcactggctaccttg
actggcagcacctgggccaactcgacacccgaggtccagaggatgatagcacccctcgcc
acggctgccgcatggggtctgaataagtgggactccatggacaactatctctcgtccctc
aagaggtactcgcctgaccgatcattctttggagcaatcctggctctccaccgaaaccag
ttccgcgaggccatcgcctgcgtgcagcaagcccgagaaggactggacaccgagctgagc
gcgttggttagcgagtcgtacaaccgagcgtaccaggttgtggtccgagttcagatgctg
gctgagctggaggaacttatcgtctacaaacagtgcgacgagaagaagcaagccattatg
agacgaacctgggagactcgattgaagggttgccagaggaacgtcgaggtttggcagcgc
atgctgcgactgcgtgctatagtgattgcaccgtcggagaacatgcacatgtggatcaag
tttgccaacctgtgccgcaagtctggcagaatgggactggccgagaagtcgctcaagcaa
ctcattggcagtgacgctcctctggagtctatgatcccctactggaacgagagaccgacg
gcgcccgggcctaggaacacagcagcgcaagtcatctacgctgtgctcaagtaccagtgg
gagctcggacagcagcccggttttaagttgtctggtaccgctgagaagactctgtactgc
ctgcgcaagtttaccaacgatgccgcccatcgcctggatattgctagagcccatctcagt
gctcagacaggcggcgacatgggtatggccactgagtacggcttccagaaccagatggac
ccttccctcatgagcccgcagactcaacgcgccttgtatgaccagacggtgctgctggcc
aagtgctacctcaggcagggcgagtggctgattgctctcaacaaggatgactggcaatac
acccaagtccaggacattcttacatcgtactcgcaagcgacaaagtacaatcctcgatgg
tacaaggcctggcatgcctgggcattggccaactttgagattgttcaggcgctgtcagcg
agaaacgaaggccacttgtcgaggacggatcaggctatggtgatagaacacgttgtcccg
gccgtcaagggcttcttcaagtcaattgccctgtcacagggaagctcgctacaggatact
cttcggttgctcacgctctggttcacacatggaggcagtgccgatgtcaacgcggccgtc
actgaaggtttcgccaacgtcagcgtcgatacatggctggaggtcattcctcagctcatt
gccagaatcaatcagcctaacaagcgcgtccagcagtccgttcataacctgcttgctgat
gtcggacgagctcaccctcaggctctggtgtaccccctgaccgtggctatgaagtcgtgg
cagaacacccgtagatcgcgctctgccgcccagattatggacagcatgcgacagcatagc
gcgaatctggttgcccaggctgacacggttagtcacgagctgatccgtgtggctgttctg
tggcatgaactttggcacgagggactggaagaagcatcacgactgtactttggcgatcac
aacattgaagggatgtttgcgactcttgagccactgcacgagcttctcgagcgaggaccc
gagacccttcgagagatctctttcgcccaggcctttggtagagatttgaaggaggctcaa
gattggtgccgacaatacgagacaagccaagatgtcaacgacctgaaccaagcctgggac
ctgtactatcaggtattccgcaggatcagcaggcaactacctcaggttacgaccctagag
ttgacatactgctcacccaagctgcttaacgccaagaatcttgacttggctgtccccgga
acgtacaagagtggacagccgatcgtgaggataatgtccttcgagacgacgtttagcgtt
atcaactctaagcaaaggccgcggaagctcaatatcaacggcagcgatggcaagtcatca
gccttcctgctcaagggacatgaagatattcgccaggacgaacgagttatgcagctgttc
ggcctgtgcaacaccctcctggcccatgactcggagtgctacaagcgccacctcaacatc
cagcggtatccggccatcccgctgtcgcagaatagtggtctgctgggctgggttcccaac
agcgatactctccacgtgctgattagggaataccgcgagagtcgcaagatcctgctcaac
attgagcaccgcatcatgctccagatggcgcccgattacgacaacctgaccttgatgcag
aaagtcgaggtctttggttatgcgcttgacaacacaacgggccaagatctgtaccgtgtg
ctgtggctcaagtccaagtcgtccgaggcctggcttgagagaagaacaaactacacacgc
tcgcttggtgtcatgtctatggtgggctatatcctgggtctgggagatcgtcatccttcc
aacctgatgctcgaccgagtcactggcaagatcatccacattgatttcggtgactgtttc
gaggttgccatgaagcgagagaaataccccgagcgggttcccttccgactgactcgcatg
ttgacgtatgcgatggaggtcagcaacattgagggtagcttcaggattacatgcgagaac
gtgatgagggtgttgagagacaacaaggagagtgtcatggctgttcttgaagcgttcatc
catgacccccttcttacctggcgattgaccaatgctgcttcgccagcaggccccaacttc
cgctctgagagagacgcaccaatccctggcgcgggaggagtccgagctagacgccagtcc
atcctcgacagcgatgttgcaccctctgagctgctcaatgcagctgagccctctgcacca
ccaacacgaagccgagccaggaccaacagctcagcagcacaagacggcaaccccatggtt
aacggcactcaggaggtggagagccagaacgcgcgagcagtcgaggtgctggaccgcgtg
gcgcagaagctcacgggtcgggactttaagaacaatgaagagctcgacgtgatcaaccag
gtcaacaagctcatcatggaggcgaccaagctggagaatctgtgccagcactatatcggt
tggtgcagcttctggtag

DBGET integrated database retrieval system