KEGG   Nitratiruptor sp. SB155-2: NIS_1137Help
Entry
NIS_1137          CDS       T00565                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nis00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1159563..1160699)
Genome map
AA seq 378 aa AA seqDB search
MTIQKIDTHIDASKLMKKIGVDKPGITIMSKKCEVMLFLIKNLHVGAANILKQDALSVGA
DVALPNGTITCAFKSVDVLLMGTRKHIEILSRKELAQPYGLKSLAKELQRYLKRNRFETK
IMGIINANDDSFYPGSRFQGEKALEAIERMIVDGADIIDIGGMSTRPGSEEISEEEELAR
VKPIIDALKKNHFPVLFSIDTYRPKVAEYALQNGFHILNDITGLESDELAQIASRYGATV
VIMHKKGRPKDMQNNPFYEDVVVEVSRFFEERIEKAKRFDIKNIILDPGIGFGKRLQDNI
ELIRDLSEFTKFGYEVLVGASRKSMIDAIVPAAVQERLPGTLAIHLKAIQNGASIIRCHD
VKEHHQAIRVYQALESIK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatacaaaagatcgatacacacattgatgcttccaaattgatgaaaaagattggt
gtcgataaacccggtatcaccatcatgtccaaaaagtgtgaagtaatgctttttttgatc
aaaaatcttcacgtgggtgctgccaatattttgaagcaggatgcattgagtgtcggggcc
gatgtagcgcttccaaacgggaccattacttgcgcattcaaatcggtcgatgttttattg
atgggaacgagaaaacatatagagattttgagtcgaaaagagcttgctcagccatatggt
ctgaaatctttggcgaaagagttgcaaagatatctgaaaagaaatcggttcgagacaaaa
ataatggggatcatcaatgccaatgatgacagtttctatcccggaagtcgatttcaagga
gaaaaagctcttgaagcgattgagagaatgatcgttgatggggcggacatcatcgatata
ggaggcatgagcaccagaccgggcagtgaagagatcagtgaagaagaggaattggcaaga
gtgaagccgattatagatgcactcaaaaaaaaccattttcctgtactgttcagcattgat
acctataggccaaaagtagccgaatatgcgttgcaaaatggatttcatatcttaaatgac
attactggactagagagtgacgagcttgcacagatagcttccaggtatggtgcgacagtt
gtcatcatgcataaaaaagggcgtccaaaggatatgcaaaacaatcctttttatgaagat
gtggttgtagaggtaagccgttttttcgaagagagaatcgaaaaagcgaaacgatttgat
atcaaaaatattattttggatcctggtatcggttttggaaagagactgcaagacaatata
gagttgatcagagatttgagtgagtttacgaaatttggttatgaggttttagtgggagcc
agtagaaaatcgatgatcgatgcaatcgttccagctgctgtgcaagagcgtcttccagga
acattggccatccatctcaaagcaattcaaaatggtgcctccatcattcgctgtcacgat
gtcaaagagcatcatcaagcaatcagggtatatcaagcattggagagtataaagtga

DBGET integrated database retrieval system