KEGG   Nitratiruptor sp. SB155-2: NIS_1604Help
Entry
NIS_1604          CDS       T00565                                 

Gene name
porD
Definition
(RefSeq) pyruvate flavodoxin oxidoreductase subunit delta (EC:1.2.7.1)
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
nis  Nitratiruptor sp. SB155-2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NIS_1604 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIS_1604 (porD)
   00020 Citrate cycle (TCA cycle)
    NIS_1604 (porD)
   00620 Pyruvate metabolism
    NIS_1604 (porD)
   00640 Propanoate metabolism
    NIS_1604 (porD)
   00650 Butanoate metabolism
    NIS_1604 (porD)
  Energy metabolism
   00680 Methane metabolism
    NIS_1604 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NIS_1604 (porD)
Enzymes [BR:nis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIS_1604 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1617288..1617719)
Genome map
AA seq 143 aa AA seqDB search
MAKDLKEIKDVEEIKDLGWDELIPGAALFSFTEPVEDVVEVPLDERPYAPTNSHEWQVGD
WRVEKPVYNRDLCIDCQFCWVFCPDISILSRDKKMIGIIYEHCKGCGICVEVCPTNPKSL
LMFPEHMENDQALAQWPKKEEKK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatttaaaagagattaaagacgtagaagagataaaagatcttggatgggat
gagctgattcctggagctgcactcttttcttttactgaacctgtagaagatgtggttgag
gttccgttagacgaacggccttacgctcccacaaactctcatgagtggcaagtaggtgat
tggcgtgtggagaaacctgtatacaatcgagatctctgcatcgactgtcagttttgctgg
gtattttgtcccgatatctccattttgagccgtgacaagaagatgatcggaattatatat
gagcactgtaaaggatgcggtatctgtgtagaggtgtgtccaacaaatcctaaatcgctt
ttgatgtttcctgaacatatggaaaacgatcaagcactggctcagtggccgaaaaaagaa
gagaagaagtaa

DBGET integrated database retrieval system