KEGG   Neisseria lactamica: NLA_15940Help
Entry
NLA_15940         CDS       T01368                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nla  Neisseria lactamica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NLA_15940 (galU)
   00052 Galactose metabolism
    NLA_15940 (galU)
   00500 Starch and sucrose metabolism
    NLA_15940 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NLA_15940 (galU)
Enzymes [BR:nla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NLA_15940 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1707236..1708105
Genome map
AA seq 289 aa AA seqDB search
MKPIKKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMIEVYERSGNSILGVETVEPSQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgataaaaaaagccgtcttccctgtcgcagggatgggaacccgcttcctgccc
gccaccaaggccagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtggaagaagccgtggaagccggctgtacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgccaggccgaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggagacgaaccctttgccgtgattctggctgacgatttaatcgatgcgcccaaa
ggcgcgctcaaacaaatgattgaggtgtacgaacgcagcggcaacagcattttgggcgta
gaaaccgtcgaaccgtcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgtcgtcggacgctatatcctcaccccgcgcattttcgacctcttaaccaatctt
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcttggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactgggc
tacctcgaagccaccgtcgcctacggcctgaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgtaccgaataa

DBGET integrated database retrieval system