KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0089Help
Entry
NMB0089           CDS       T00027                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0089 (pykA)
   00620 Pyruvate metabolism
    NMB0089 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0089 (pykA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     NMB0089 (pykA)
Membrane trafficking [BR:nme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NMB0089 (pykA)
Exosome [BR:nme04147]
 Exosomal proteins
  Proteins found in most exosomes
   NMB0089 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(101492..102964)
Genome map
AA seq 490 aa AA seqDB search
MNQTSRDLTRISHNTKIVATLGPGSNNVELLEDMIRVGGLNVVRFNFSHGTPEFHQENAL
IVREAAKRAGQEIAIIADLQGPKIRVGKIAGGGIELNKGETLVLDAALEGEGTREAVGLD
YRDLPDDVAAGDVLWLDDGLLTLTVESVEGSRIITRVENSHVLKSNKGINKRGGGLSAGA
LTEKDFRDLKTAIAIGCDYLAISFVKSAEDLHIARAKVEEEMKGSTAVRPGLVSKIERVE
AIENLDEIILAGDGIMVARGDLAVEVGHAAVPALQKRMIRRARELRRFSITATQMMESMI
TNPVPTRAEVSDVANAVLDGTDAVMCSAETAVGAYPFETVSQMAIICAAAEKEQDSLNGV
AEQVEYPEAVSTNLAVAGGAVSVARAVHAKAIVALTESGSTAFEISRHNITLPIFALTPS
VSAQRRMAMYRGVRPLILATSTDHDTALNEVETMLVEHNILHSGDQYIITSGSQMRESGS
TNTLEVLRVK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacaagccgcgatctgacccgcatcagccacaacactaaaatcgtcgccacc
cttgggccgggcagcaacaacgtcgaactgttggaagacatgatccgcgtcggcggtctg
aacgtcgtccgcttcaacttcagccacggcacgcccgaattccatcaggaaaacgccctc
atcgtgcgcgaggcggcaaaacgcgccggacaggaaatcgccatcattgccgacctgcag
ggcccgaaaatccgcgtgggcaaaatcgccggcggcggcatcgaattgaacaaaggcgaa
acgctggtactggatgccgcgctcgaaggcgaaggcacgcgcgaggcggtcggtttggac
taccgcgacctgcccgacgacgttgccgcaggcgatgtcttgtggctggacgacggcctg
ctgaccctgaccgtggaatccgtcgaaggcagcaggattatcacaagggtggaaaacagc
cacgtcctgaaaagcaacaagggcatcaacaaacgcggtggcggtctgtccgcaggcgcg
ttgaccgaaaaagacttccgcgacctgaaaaccgcgattgccatcggttgcgactacctc
gccatcagctttgtgaaatccgccgaagatttgcatatcgcgcgcgccaaagtcgaagaa
gaaatgaagggcagcacggccgtgcgccccggtttggtttccaaaatcgaacgcgtggaa
gcgattgaaaacttggacgaaatcatcctcgccggcgacggcattatggttgcgcgcggc
gacttggcggtcgaagtcggacacgccgccgtccccgccctgcaaaaacggatgatccgc
cgcgcccgcgagttgcgccgcttcagcattacggcgacgcaaatgatggaatcgatgatt
accaaccccgtaccgacccgcgcggaagtcagcgatgtggcaaacgcggtattggacggt
accgatgcggtgatgtgttccgccgaaaccgccgtcggcgcgtatccgtttgaaaccgtc
agccaaatggcgattatctgcgcggctgcggaaaaagagcaggattcgctcaacggcgtt
gccgaacaggtcgagtatcccgaagcggtcagcaccaacctggcggttgccggcggtgcg
gtcagcgtggcgcgcgcggttcacgccaaagccatcgtcgccctgaccgaaagcggttcg
accgcctttgaaatcagccgccacaacatcaccctgccgattttcgcgctgaccccgagc
gtttccgcccaacgccgtatggcgatgtaccggggcgtgcgcccgctgattttggcaacc
agtaccgaccacgacacggcgttaaacgaagtcgaaacgatgctggtggaacacaacatc
ctgcattccggcgaccaatacatcattaccagcggttcgcaaatgcgcgaatccggttcg
accaacacactggaagtgctgcgcgtcaaataa

DBGET integrated database retrieval system