KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1021Help
Entry
NMB1021           CDS       T00027                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
nme02024  Quorum sensing
Module
nme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1021 (trpE)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    NMB1021 (trpE)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1021 (trpE)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     NMB1021 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 903159
NCBI-ProteinID: NP_274055
UniProt: P56995
Position
complement(1035922..1037397)
Genome map
AA seq 491 aa AA seqDB search
MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYS
FIGLPCSHYLKASGKHVDVYQNGEIVEQHDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLV
GYFGYETIYNFEHFAHRLKNTTKADPLGTPDILLMLSQELAVIDNLSGKIHLVVYADPSQ
PDGYERARERLEDIRTQLRQSCAIPLSLGSKHTEAVSEFGEEPFKACVNKIKDYIFAGDC
MQVVPSQRMSMEFTDSPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERNDVI
VRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKM
VIEKYSHVMHIVSNVEGRLKDGMTNMDILAATFPAGTLSGAPKVRAMEIIEEVEPSKRGI
YGGAVGVWGFNNDMDLAIAIRTAVVKNNTLYVQSGAGVVADSDPASEWQETQNKARAVIH
AAQMVQEGLDK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaaacaagaataccaagcccaagccgcccaaggctacaaccgcatcccgctc
gtgcaagaactccttgccgatttggatacgccgctttccctctatctcaaactcgccaac
cgcccctatacctacctgctcgaatccgttgtcggtggcgaacgtttcggccgctattct
tttatcggcctgccttgcagccactatctcaaagccagcggcaaacacgtcgatgtttat
caaaacggcgaaattgtcgagcaacacgacggcaaccccctgccctttatcgaagccttc
cacaaccgcttcaaaacacccgaaatcccaagcctgccgcgctttaccggcggactggtc
ggctacttcggttacgaaaccatctacaattttgaacacttcgcccaccgcctgaaaaac
accaccaaagccgacccgctcggcacgcccgacatcttgctgatgctgtcgcaagaattg
gcggtgatcgacaatttgagcggcaaaatccatctcgtcgtttacgccgatccgtcgcag
cccgacggctacgaacgcgcccgcgaacgcctcgaagacatccgcacccagttgcgccaa
agctgcgccatcccgctctcgctcggcagcaaacacaccgaagccgtcagcgaattcggc
gaagagccgttcaaagcctgcgttaacaaaatcaaagactacatcttcgcaggcgactgc
atgcaggttgtccccagccagcgcatgagcatggaattcaccgacagcccgctcgccctc
taccgcgccctgcgtacgctcaacccttcgccttatctcttttactacgatttcggcgat
ttccacatcgtcggctcctcgcccgaaatcctcgtccgacgcgaacgcaacgacgttatc
gtccgccccatcgccggcacgcgcctgcgcggcaaaacccccgccgaagaccttgccaac
gaacaagatttgttaagcgatgccaaagaaatcgccgaacacgtcatgttgattgactta
ggacgcaacgacgtcggccgcatcagtaaaaccggcgaagtcaaagttaccgacaaaatg
gtgattgaaaaatactcccatgtaatgcacatcgtttccaacgtcgaaggccgtctgaaa
gacggcatgaccaacatggacatcctcgccgctaccttccctgccggcacactctccggc
gcacccaaagtccgcgccatggaaatcatcgaagaagtcgaaccgagcaaacgcggcatc
tacggcggtgccgtcggcgtatggggtttcaacaacgacatggatttggcaatcgccatc
cgcaccgccgtagtaaaaaacaacacgctatacgtccaaagcggcgcgggcgtggttgcc
gactccgatccggcctccgaatggcaggaaacacaaaacaaagcccgagccgtcatacac
gccgcgcaaatggtacaggaagggttggataaatga

DBGET integrated database retrieval system