KEGG   Neisseria meningitidis MC58 (serogroup B): NMB1021Help
Entry
NMB1021           CDS       T00027                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMB1021 (trpE)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB1021 (trpE)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    NMB1021 (trpE)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    NMB1021 (trpE)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     NMB1021 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1035922..1037397)
Genome map
AA seq 491 aa AA seqDB search
MISKQEYQAQAAQGYNRIPLVQELLADLDTPLSLYLKLANRPYTYLLESVVGGERFGRYS
FIGLPCSHYLKASGKHVDVYQNGEIVEQHDGNPLPFIEAFHNRFKTPEIPSLPRFTGGLV
GYFGYETIYNFEHFAHRLKNTTKADPLGTPDILLMLSQELAVIDNLSGKIHLVVYADPSQ
PDGYERARERLEDIRTQLRQSCAIPLSLGSKHTEAVSEFGEEPFKACVNKIKDYIFAGDC
MQVVPSQRMSMEFTDSPLALYRALRTLNPSPYLFYYDFGDFHIVGSSPEILVRRERNDVI
VRPIAGTRLRGKTPAEDLANEQDLLSDAKEIAEHVMLIDLGRNDVGRISKTGEVKVTDKM
VIEKYSHVMHIVSNVEGRLKDGMTNMDILAATFPAGTLSGAPKVRAMEIIEEVEPSKRGI
YGGAVGVWGFNNDMDLAIAIRTAVVKNNTLYVQSGAGVVADSDPASEWQETQNKARAVIH
AAQMVQEGLDK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaaacaagaataccaagcccaagccgcccaaggctacaaccgcatcccgctc
gtgcaagaactccttgccgatttggatacgccgctttccctctatctcaaactcgccaac
cgcccctatacctacctgctcgaatccgttgtcggtggcgaacgtttcggccgctattct
tttatcggcctgccttgcagccactatctcaaagccagcggcaaacacgtcgatgtttat
caaaacggcgaaattgtcgagcaacacgacggcaaccccctgccctttatcgaagccttc
cacaaccgcttcaaaacacccgaaatcccaagcctgccgcgctttaccggcggactggtc
ggctacttcggttacgaaaccatctacaattttgaacacttcgcccaccgcctgaaaaac
accaccaaagccgacccgctcggcacgcccgacatcttgctgatgctgtcgcaagaattg
gcggtgatcgacaatttgagcggcaaaatccatctcgtcgtttacgccgatccgtcgcag
cccgacggctacgaacgcgcccgcgaacgcctcgaagacatccgcacccagttgcgccaa
agctgcgccatcccgctctcgctcggcagcaaacacaccgaagccgtcagcgaattcggc
gaagagccgttcaaagcctgcgttaacaaaatcaaagactacatcttcgcaggcgactgc
atgcaggttgtccccagccagcgcatgagcatggaattcaccgacagcccgctcgccctc
taccgcgccctgcgtacgctcaacccttcgccttatctcttttactacgatttcggcgat
ttccacatcgtcggctcctcgcccgaaatcctcgtccgacgcgaacgcaacgacgttatc
gtccgccccatcgccggcacgcgcctgcgcggcaaaacccccgccgaagaccttgccaac
gaacaagatttgttaagcgatgccaaagaaatcgccgaacacgtcatgttgattgactta
ggacgcaacgacgtcggccgcatcagtaaaaccggcgaagtcaaagttaccgacaaaatg
gtgattgaaaaatactcccatgtaatgcacatcgtttccaacgtcgaaggccgtctgaaa
gacggcatgaccaacatggacatcctcgccgctaccttccctgccggcacactctccggc
gcacccaaagtccgcgccatggaaatcatcgaagaagtcgaaccgagcaaacgcggcatc
tacggcggtgccgtcggcgtatggggtttcaacaacgacatggatttggcaatcgccatc
cgcaccgccgtagtaaaaaacaacacgctatacgtccaaagcggcgcgggcgtggttgcc
gactccgatccggcctccgaatggcaggaaacacaaaacaaagcccgagccgtcatacac
gccgcgcaaatggtacaggaagggttggataaatga

DBGET integrated database retrieval system