KEGG   Nitrosospira multiformis: Nmul_A0422Help
Entry
Nmul_A0422        CDS       T00302                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family protein (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmul_A0422
   01230 Biosynthesis of amino acids
    Nmul_A0422
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A0422
  Energy metabolism
   00680 Methane metabolism
    Nmul_A0422
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmul_A0422
Enzymes [BR:nmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Nmul_A0422
Exosome [BR:nmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Nmul_A0422
  Exosomal proteins of melanoma cells
   Nmul_A0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(469345..470058)
Genome map
AA seq 237 aa AA seqDB search
MTQLVLLRHGESVSNRDGCFTGWGDAPLTPRGEREAEQAGNLLKKAGHKFDICFTSELSR
ANDTLRIVLSVMGQDEPVVQRNWRLNERHYGALEGINRWKAIRKYGFCPILSSQCRFDAP
PPPLDPADIRFPGNQACYATIDPGELPLGESMRQAFARMLPYWQQTITPEIQRGKRVLIV
AHKHILRGLIMQLDGLSIIQLIKLSVATGRPLIYELDDNLHPIRHYYADTGLTGHTG
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactcgttctgctgcgacatggagaaagcgtctcgaaccgcgacggatgcttt
accgggtggggggatgctcctttgacgccccgaggcgagcgggaggcagagcaggcgggc
aatctcttgaaaaaagcaggacacaagttcgatatctgcttcacctccgagctcagccgc
gcgaatgacacgctccgcatcgtgctatcggtcatggggcaggatgaaccggtggtgcaa
cgaaactggcgcttgaatgaacgccactatggggctctggaaggaatcaatcgctggaag
gcaatcaggaaatacggcttttgccctattctcagttcgcaatgccgttttgatgctccg
ccacccccacttgatcctgccgatatccgttttcccggaaaccaggcgtgctatgcaacc
atcgatcctggggaactgccgcttggtgagagcatgcgacaagccttcgcgcgaatgctg
ccttactggcagcaaacaatcaccccggaaatccagcgcggcaagcgagtgctcattgtc
gcccacaagcatatcctgagagggttgataatgcagttggatggcctatccattattcag
ctcataaaattgtcagtggccactggtcgtccactgatctatgagcttgacgataacctg
catccaatccggcattactacgcagacaccggattgaccggccatacaggttga

DBGET integrated database retrieval system