KEGG   Nostoc sp. PCC 7524: Nos7524_3130Help
Entry
Nos7524_3130      CDS       T02363                                 

Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
nop  Nostoc sp. PCC 7524
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nop00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nos7524_3130
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_3130
   00620 Pyruvate metabolism
    Nos7524_3130
   00650 Butanoate metabolism
    Nos7524_3130
  Lipid metabolism
   00071 Fatty acid degradation
    Nos7524_3130
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nos7524_3130
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nos7524_3130
   00626 Naphthalene degradation
    Nos7524_3130
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nos7524_3130
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Nos7524_3130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3786468..3789140)
Genome map
AA seq 890 aa AA seqDB search
MQVTNIEELELLVQRVKTAQAKYSNYSQEQVDVIFKKAALAANAERIPLAKLAVAETGMG
IVEDKVIKNHFASEFIYNKYKHEKTCGIIEEDHTFGIQKISEPVGIVAGIVPVTNPTATT
IFKALIALKTRNAIIFSPHPKSKKCTVEAAKIILKAAISAGAPEDIIGWIDEPTVELSKA
LMQHSEIKLILATGGPGMVRAAYSSGNPSLGVGAGNTPAVIDSSAHIQTAVSSILLSKTF
DNGMICASEQSVVVVDDIYEKVKQEFICRGAYFLNDEEKQKLGSVILKEGRLNPAIVGQS
VDNLAKLAGISLPNDTDASQAPKIYKVLIGEVETVGEGEAFAYEKLSPILAMYRAANFPE
AVDKAEKLVEFGGLGHTSVLYTNPANLDDIAYFENKMKTGRVLINTPSSQGAIGDLYNFK
LDPSLTLGCGTWGGNTVSDNVTPHHLVNIKTVSQRRQNMLWFRVPPKVYFKYGCLPVALR
DLVGKERAFIVTDKQLFDLGIVDKVTQVLDEIGVKHDVFHDVEPDPTLSNVNKGLALLRS
YQPDVIIAIGGGSPMDAAKVMWLMYEHPDVEFEGLAMRFMDIRKRVYELPPLGQKAIMVA
IPTTSGTGSEVTPFAVVTDDRVGVKYPLADYALTPNIAIADPELVSNMPKKLTAYGGIDA
LTHALESYVSVMASEFTDGLALQAIRLLFKYLPSAYQNGANDPKAREKVHYAATIAGMAF
ANAFLGICHSMAHKLGATFHVPHGLANALMISHVIRYNATDIPFKQAIFPQYKYPNAKDR
YAQIADHLHLGGNTADEKVELLVSAIENLKRQIDIPATIKQALGDEDQEFYAKLEEMAEQ
AFDDQCTGANPRYPLMNDLKELYVLAYQGCRIDAALYHNSDAAILRGVGV
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcactaatatcgaagaattagaattacttgtgcaacgagttaaaactgcacaa
gctaaatactcaaattactctcaagaacaagtcgatgtcatctttaaaaaggcggcatta
gctgctaatgccgaacggattcccctagcaaaattggcagtagcagaaacaggtatgggg
attgtcgaagataaagtgattaaaaatcactttgcttcggaatttatctacaataaatac
aagcatgaaaaaacctgcgggatcattgaagaagaccatacatttggcattcaaaagata
tctgagcctgtagggattgttgccggaattgtccccgtaactaatcctactgctacaaca
atttttaaagcgttaattgctttaaaaactcgtaacgccattattttttcaccccatccc
aaatctaaaaaatgtactgtagaagcagcaaaaattattctgaaagctgcaatttccgca
ggtgcgccagaggatattattggttggattgatgagccaacggtagagttatccaaagct
ttaatgcagcattcagaaattaaattaattttagccactggcgggccaggaatggtacgt
gctgcttattcttctggaaatccatcgttaggtgtgggtgctggtaatactccagcagtc
attgatagcagcgcacatattcaaactgctgtgagttcaattttattaagtaaaaccttt
gacaacggcatgatttgtgcttcggaacaatcagttgttgtagttgatgatatttacgaa
aaagtcaaacaggaatttatctgccggggcgcatattttctcaatgatgaggaaaaacaa
aagctgggtagtgtaattttgaaagagggcagattaaatcccgctattgtcggacagtca
gtcgataatttagctaaattagccggaatttcactgccaaatgataccgatgcttcccaa
gccccaaagatttataaagtcttaattggtgaagttgaaacagtgggagaaggtgaagct
tttgcctatgaaaaattatcgccaattttggctatgtatcgggctgcaaattttcctgaa
gcagtagataaagctgaaaaattggtggaatttgggggattgggacatacatcagttttg
tatacaaatcccgccaatctggatgatattgcctattttgagaacaaaatgaaaaccggg
cgtgttttgattaataccccatcttctcaaggtgcaattggtgatttatataactttaaa
cttgatccatctttaactttaggttgcgggacttggggaggtaatacagtttccgataac
gtcacaccccatcaccttgtcaatattaaaacggtatcccaacgtcgccaaaatatgttg
tggtttcgtgttccacccaaagtatattttaaatatgggtgtttgcctgtagctttacgt
gatttagtagggaaagaacgcgcttttatcgttacagataaacaattatttgatttagga
atagtcgataaagttacccaggtgttagacgaaattggcgtaaaacatgacgtgtttcac
gatgttgaacctgatcccacattatccaacgtcaataaaggattagccttactcagaagc
tatcaaccagatgtaattattgccattggtgggggttcgccaatggatgcagccaaagtc
atgtggttgatgtacgaacatcccgatgtggaatttgaaggcttggcgatgcggtttatg
gatatccgcaagcgagtttatgaattaccacccttgggacaaaaagccatcatggtggcg
attcccacaacatccgggactggttcagaagtgacaccctttgctgtggtgacagatgac
agagtaggcgtgaaataccccttagcagattatgccctaactccgaatattgcgatcgcc
gacccggaactcgtctcaaatatgcccaaaaaactcacagcctacggtgggattgatgct
ttaactcatgccttagaatcctacgtatccgtaatggctagcgaatttacagatggtttg
gcattgcaagcaattagactattgtttaaatatttacccagtgcttaccaaaatggtgct
aatgatccgaaagcacgggaaaaagtccattatgccgccacaattgccggtatggccttt
gcgaatgcgttcttgggtatttgtcactcaatggcacacaaactcggtgcaaccttccac
gtcccccacggactcgccaacgccttgatgatttcccacgtcatccgctacaacgctacg
gatattccattcaagcaagcaatttttccccagtacaaatatcctaatgctaaagacaga
tatgctcaaatagctgatcacctgcatttaggtggcaatacagccgatgaaaaagtggaa
ttattggtatctgcaattgaaaatctcaaacgtcaaattgatattcctgccacaattaaa
caagctttaggagacgaagatcaagagttctacgccaagttggaagagatggcagaacaa
gcatttgatgatcaatgcaccggagcaaatccacgctatccactaatgaacgacttgaaa
gaattatatgtcttagcctatcaaggttgtcggatagacgcagcactatatcacaacagt
gatgcggcaattctcaggggtgtaggggtgtag

DBGET integrated database retrieval system