KEGG   Natronococcus occultus: Natoc_2876Help
Entry
Natoc_2876        CDS       T02426                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nou  Natronococcus occultus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natoc_2876
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natoc_2876
   00640 Propanoate metabolism
    Natoc_2876
   00660 C5-Branched dibasic acid metabolism
    Natoc_2876
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Natoc_2876
Enzymes [BR:nou01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Natoc_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2767271..2768422)
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKQVFADAGIPTPESELASDVDGVLTAAEEIGYPVAVKAQVQVGGRGKAGGIE
LVENEEEAREAAESIIGMDLKGYHVDQVLVEGAVDFVDELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPEAIAREHIDPSFGMHPYQARKAVYDAGVDKAVARDVSSVLTTLYQLW
DDRDGSDAEINPLMVTDDDEVIAADAVMNIDEDALFRQPELAEMEAEAASGGDDLEQKAD
EYDFDYVRLEGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAERIANALDMVF
SDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDL
VTVEQTLEDAVQRAVEYAEEGQA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgagtaccaggcgaagcaagtcttcgccgacgccggaattccgacgccg
gagtcagagctcgcttcggacgtcgacggcgtactgaccgcagccgaggagatcggctat
ccggtcgcggtcaaggcacaggtacaggtcggcggtcgggggaaagccggcgggatcgaa
ctcgtcgagaacgaggaggaggcccgcgaggcagccgaatcgatcatcgggatggacctc
aaggggtatcacgtcgatcaggttctcgtcgagggagcggtcgacttcgtcgacgaactg
tacgtcggcatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgacgaag
ggtggcgtcaacatcgaggaggtcgccgaggaggatcccgaggcgatcgcccgcgaacac
atcgacccttcctttggcatgcacccctaccaggcccgcaaggccgtttacgacgccggc
gtcgacaaggccgtcgcccgcgacgtctcgagcgtgctgacaacgctctaccagctctgg
gacgaccgtgacggctccgacgcggagatcaacccgctgatggtcaccgacgacgacgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggacgcactgttccgccagcccgaa
ctggccgagatggaggccgaggccgcaagcggcggcgacgacctcgagcagaaggccgac
gagtacgacttcgactacgttcggctggaggggaacacgggcatcatcggtaacggcgcc
ggtctcgtgatgaccacgctcgacctggtcgatcactacggcggcgagcccgcgaacttc
ctggacgtcggtggcggcgcgaaggccgagcgaatcgcgaacgcgctcgatatggtgttc
tcggacgacaacgtcgacagcgtcgtcttcaacatcttcggcgggatcacccgtggcgac
gaggtcgcccgcgggatcaacgaggccctggagcagttcgacgagatcccgaagccggtc
gtcgtccgactggccgggaccaactgggaggaaggtatggagattctcaacgaggacctc
gtgacggtcgaacagaccctcgaggacgcggtccagcgtgccgtcgagtacgctgaggag
ggacaagcatga

DBGET integrated database retrieval system