KEGG   Natronococcus occultus: Natoc_2876Help
Entry
Natoc_2876        CDS       T02426                                 

Definition
succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nou  Natronococcus occultus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nou01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nou00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nou00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:nou00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2767271..2768422)
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKQVFADAGIPTPESELASDVDGVLTAAEEIGYPVAVKAQVQVGGRGKAGGIE
LVENEEEAREAAESIIGMDLKGYHVDQVLVEGAVDFVDELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPEAIAREHIDPSFGMHPYQARKAVYDAGVDKAVARDVSSVLTTLYQLW
DDRDGSDAEINPLMVTDDDEVIAADAVMNIDEDALFRQPELAEMEAEAASGGDDLEQKAD
EYDFDYVRLEGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAERIANALDMVF
SDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDL
VTVEQTLEDAVQRAVEYAEEGQA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgagtaccaggcgaagcaagtcttcgccgacgccggaattccgacgccg
gagtcagagctcgcttcggacgtcgacggcgtactgaccgcagccgaggagatcggctat
ccggtcgcggtcaaggcacaggtacaggtcggcggtcgggggaaagccggcgggatcgaa
ctcgtcgagaacgaggaggaggcccgcgaggcagccgaatcgatcatcgggatggacctc
aaggggtatcacgtcgatcaggttctcgtcgagggagcggtcgacttcgtcgacgaactg
tacgtcggcatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgacgaag
ggtggcgtcaacatcgaggaggtcgccgaggaggatcccgaggcgatcgcccgcgaacac
atcgacccttcctttggcatgcacccctaccaggcccgcaaggccgtttacgacgccggc
gtcgacaaggccgtcgcccgcgacgtctcgagcgtgctgacaacgctctaccagctctgg
gacgaccgtgacggctccgacgcggagatcaacccgctgatggtcaccgacgacgacgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggacgcactgttccgccagcccgaa
ctggccgagatggaggccgaggccgcaagcggcggcgacgacctcgagcagaaggccgac
gagtacgacttcgactacgttcggctggaggggaacacgggcatcatcggtaacggcgcc
ggtctcgtgatgaccacgctcgacctggtcgatcactacggcggcgagcccgcgaacttc
ctggacgtcggtggcggcgcgaaggccgagcgaatcgcgaacgcgctcgatatggtgttc
tcggacgacaacgtcgacagcgtcgtcttcaacatcttcggcgggatcacccgtggcgac
gaggtcgcccgcgggatcaacgaggccctggagcagttcgacgagatcccgaagccggtc
gtcgtccgactggccgggaccaactgggaggaaggtatggagattctcaacgaggacctc
gtgacggtcgaacagaccctcgaggacgcggtccagcgtgccgtcgagtacgctgaggag
ggacaagcatga

DBGET integrated database retrieval system