KEGG   Natronococcus occultus: Natoc_2876Help
Entry
Natoc_2876        CDS       T02426                                 

Definition
succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nou  Natronococcus occultus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Natoc_2876
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Natoc_2876
   00640 Propanoate metabolism
    Natoc_2876
   00660 C5-Branched dibasic acid metabolism
    Natoc_2876
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Natoc_2876
Enzymes [BR:nou01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Natoc_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2767271..2768422)
Genome map
AA seq 383 aa AA seqDB search
MKLHEYQAKQVFADAGIPTPESELASDVDGVLTAAEEIGYPVAVKAQVQVGGRGKAGGIE
LVENEEEAREAAESIIGMDLKGYHVDQVLVEGAVDFVDELYVGITMDRGEGKPVAMVSTK
GGVNIEEVAEEDPEAIAREHIDPSFGMHPYQARKAVYDAGVDKAVARDVSSVLTTLYQLW
DDRDGSDAEINPLMVTDDDEVIAADAVMNIDEDALFRQPELAEMEAEAASGGDDLEQKAD
EYDFDYVRLEGNTGIIGNGAGLVMTTLDLVDHYGGEPANFLDVGGGAKAERIANALDMVF
SDDNVDSVVFNIFGGITRGDEVARGINEALEQFDEIPKPVVVRLAGTNWEEGMEILNEDL
VTVEQTLEDAVQRAVEYAEEGQA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgagtaccaggcgaagcaagtcttcgccgacgccggaattccgacgccg
gagtcagagctcgcttcggacgtcgacggcgtactgaccgcagccgaggagatcggctat
ccggtcgcggtcaaggcacaggtacaggtcggcggtcgggggaaagccggcgggatcgaa
ctcgtcgagaacgaggaggaggcccgcgaggcagccgaatcgatcatcgggatggacctc
aaggggtatcacgtcgatcaggttctcgtcgagggagcggtcgacttcgtcgacgaactg
tacgtcggcatcacgatggaccgcggcgagggcaagcccgtcgcgatggtctcgacgaag
ggtggcgtcaacatcgaggaggtcgccgaggaggatcccgaggcgatcgcccgcgaacac
atcgacccttcctttggcatgcacccctaccaggcccgcaaggccgtttacgacgccggc
gtcgacaaggccgtcgcccgcgacgtctcgagcgtgctgacaacgctctaccagctctgg
gacgaccgtgacggctccgacgcggagatcaacccgctgatggtcaccgacgacgacgag
gtcatcgcggccgacgccgtgatgaacatcgacgaggacgcactgttccgccagcccgaa
ctggccgagatggaggccgaggccgcaagcggcggcgacgacctcgagcagaaggccgac
gagtacgacttcgactacgttcggctggaggggaacacgggcatcatcggtaacggcgcc
ggtctcgtgatgaccacgctcgacctggtcgatcactacggcggcgagcccgcgaacttc
ctggacgtcggtggcggcgcgaaggccgagcgaatcgcgaacgcgctcgatatggtgttc
tcggacgacaacgtcgacagcgtcgtcttcaacatcttcggcgggatcacccgtggcgac
gaggtcgcccgcgggatcaacgaggccctggagcagttcgacgagatcccgaagccggtc
gtcgtccgactggccgggaccaactgggaggaaggtatggagattctcaacgaggacctc
gtgacggtcgaacagaccctcgaggacgcggtccagcgtgccgtcgagtacgctgaggag
ggacaagcatga

DBGET integrated database retrieval system