KEGG   Natronococcus occultus: Natoc_4036Help
Entry
Natoc_4036        CDS       T02426                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
nou  Natronococcus occultus
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nou00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Natoc_4036
Enzymes [BR:nou01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Natoc_4036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3977249..3978292
Genome map
AA seq 347 aa AA seqDB search
MQAARLHEYTDEMSEALEVEEVDRPELEKSDEVLVEVSGAGWCQTDNHIIEGMWEEYAPQ
DLPMTLGHENAGIVAEVGEEVTLVEEGDPVICHPVQTCGICRPCRLGEDMYCENSAFNGL
TTDGGFAEYLQTNERAVIPLPDGVDPTEIAPHADAGITAYHAAKKAVRELNPGDTCVVIG
VGGLGHIGLQCLDAMSAADVVAADLKDEALKLAEDLGARHTINSGEDDLASTVLDLTDDE
GAQQVLDFVGADETTATAPEMVAAGGDHHVIGYGGHIHEPCQALVDGEFSFKGTLVGKYA
ELQELVALVDRGDVELRTEVYDLSDINTVAERLEHREIEGRAVITPP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcccgtctccacgagtacaccgacgagatgagcgaggctctcgaggtagag
gaggtcgatcgtccggagctcgagaagtccgacgaagtcctggtcgaggtctccggcgcc
ggttggtgtcagacagacaaccacatcatcgaaggaatgtgggaggagtatgctccgcag
gacctgccgatgacgctaggccatgagaacgcgggcatcgtcgcggaagtcggcgaagag
gtgacgctcgtcgaggagggcgacccggtgatctgtcaccccgtccagacctgcgggatc
tgccggccctgtcggctcggcgaggacatgtactgcgagaacagcgccttcaacgggctg
acgaccgacggcgggttcgcggagtatctccagaccaacgagcgcgcggtgatcccgctc
cccgacggcgtcgatccgaccgagatcgcgccccacgccgacgcggggatcacggcctac
cacgccgcgaagaaggcggtccgcgagctgaacccgggcgacacctgcgtcgtcatcggc
gtcggcgggctgggccacatcgggctgcagtgtctcgacgcgatgagcgcggccgacgtc
gtcgccgccgacctcaaggacgaggccctcaagctggccgaggacctcggcgcccgccac
acgatcaactccggcgaggacgacctcgcgagcaccgtactggacctgaccgacgacgag
ggcgcccagcaggtgctcgatttcgtcggggccgacgagaccaccgcgaccgcgccggag
atggtcgccgcgggcggcgaccaccacgtgatcggttacggcggccacatccacgagccg
tgtcaggcgctggtcgacggcgagttctcgtttaaggggacgctggtcggaaagtacgcc
gagctccaggagctggtcgcgctcgtcgaccgcggggacgtcgagctgcggaccgaggtc
tacgacctctcagacatcaacaccgtcgcggaacgcctcgagcaccgcgagatcgagggt
cgagcggtgatcaccccaccctga

DBGET integrated database retrieval system