KEGG   Novosphingobium sp. PP1Y: PP1Y_AT26396Help
Entry
PP1Y_AT26396      CDS       T01515                                 

Definition
ABC transporter
Orthology
K06158  
ATP-binding cassette, subfamily F, member 3
Organism
npp  Novosphingobium sp. PP1Y
Brite
Translation factors [BR:npp03012]
 Eukaryotic Type
  Initiation factors
   Initiation associated factors
    PP1Y_AT26396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2768575..2770458
Genome map
AA seq 627 aa AA seqDB search
MLTIRELSVRLGGRTILDQATATIPHGGKVGLIGRNGAGKSTLVKAIIGEIEPDGGGAEM
PRRARLGYIAQEAPSGTRTPFEAVLEADAERTALLAESETCTDPHRLGDVHERLIAIDAY
SAPARAARILVGLGFDEEMQSRPLDSFSGGWKMRVALAALLFSAPDVLLLDEPSNHLDLE
ATLWLESFLQSYPGTLIVISHERDLLNTVVDHILHLQQGKLTLYPGTYDSFERIRAERVA
QAEAARANQEAQRKKLADYVARNSARASTAKQAQSRAKMLAKMQPIAAMSEDPSLSFDFP
SPDELRPPLVTLDLAAVGYTPGEPVLKRLNLRIDPEDRIALLGRNGNGKTTLARLLAQQL
EPMEGAITFSGKIRIGYFTQYQVEELPSGSTPLELMTRAMADKPPQAVRNQLGRFGFSGE
RATAETHTLSGGERARLALALVTRDAPHLLILDEPTNHLDVDAREALVQALNAFEGAVIL
VSHDRHMVELAADRLVLVDEGTAKPYDGSMEDYIDFVLGRNQPKTEDRPGASEAKPQRKA
GAIAREELKAARRKVSEAETRLSRLQKQLDELDNALVEPTKAKGELARLGIGEIGKRRTA
AAEQLEEAEMAWLEASEALESVMGGAA
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgatccgcgaactgtccgtgcgccttggtgggcgcactatccttgaccaggcc
actgcaaccattccccatggcgggaaggtggggctgatcggccgcaacggcgccggcaag
tcgacgctggtcaaggcgatcatcggcgagatcgagcctgacggcggcggcgccgaaatg
ccgcgccgcgcgcgtctgggctacatcgcccaggaagcgccgagcggcacccgcacgcct
ttcgaagccgtgctggaagccgacgcggagcgcactgcgctgctggccgaatccgaaacc
tgcaccgatccacatcgcctcggcgacgtgcacgagcggctgatcgcaatcgacgcttac
agcgcccctgcccgcgctgcgcgcattctggtcggcctcggcttcgacgaggaaatgcag
tcgcgaccgctcgacagcttctcgggcggctggaagatgcgcgtggcccttgccgcgctg
ctgttctcggcccctgacgtgctgctgctcgacgaaccgtcgaaccacctcgaccttgag
gcaacgctctggctggaaagcttcctgcaaagctatcccggcacgctcatcgtcatcagc
cacgagcgagacctgctcaacaccgtggtcgatcacatcctgcacctgcagcagggcaag
ctcacgctttatccgggcacttacgacagcttcgagcgcatccgcgccgagcgcgtggcg
caggccgaagccgcgcgtgccaaccaggaagcacagcgcaagaagctggccgactatgtc
gcgcgcaacagcgctcgtgcttccaccgccaagcaggcgcagtcgcgcgccaagatgctg
gccaagatgcagccgatcgcggcgatgagcgaggatccctcgctcagcttcgacttcccg
agcccggacgaactgcgcccgccgctggtcacgctcgatcttgccgccgtcggctacacg
ccgggcgaaccggtcctcaagcggctgaacctgcggatcgacccggaggaccgcattgcc
ctgctcggtcgcaacggcaacggcaagaccacgcttgcgcgcctgctcgcgcagcagttg
gaaccgatggaaggcgcaattaccttctccggcaagatccggatcggctacttcacccag
taccaggtcgaggaactgccgagcggatccactccgctcgagctgatgacccgcgcgatg
gccgacaagccgccgcaggccgtgcgcaaccaactgggccgtttcggcttttccggggag
cgggcgacggcggaaacgcataccctgtccggcggcgagcgcgcgcgcctggcccttgcc
ctcgtcacccgcgatgcgccgcacctgctgatcctcgacgagccgaccaaccacctcgac
gtcgatgcacgcgaggcactcgtacaggcgctcaatgccttcgaaggcgctgtcatcctc
gtcagccacgatcgccacatggtcgaactcgcagccgaccggctggtgctggtcgatgag
ggtacggccaagccctacgacggatcgatggaggactatatcgacttcgtcctcgggcgt
aaccaacccaagaccgaagaccggcccggcgcttcggaagccaagccgcagcgcaaggcg
ggagccatcgcccgcgaagaactcaaggccgcgcgccgcaaggtgtcggaagccgagacg
cgcttgtcgcgcctgcaaaagcagctcgacgaactcgacaatgctctcgtcgaacctacc
aaggccaagggagaacttgcgcgcctgggcatcggcgaaatcggcaagcggcgtacggcg
gcagcagagcagcttgaggaagcggagatggcgtggctggaggccagcgaagcgcttgaa
tcggtgatggggggcgcagcatga

DBGET integrated database retrieval system