KEGG   Nostoc punctiforme: Npun_R1262Help
Entry
Npun_R1262        CDS       T00713                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
npu  Nostoc punctiforme
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:npu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Npun_R1262
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Npun_R1262
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_R1262
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Npun_R1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(1518683..1519912)
Genome map
AA seq 409 aa AA seqDB search
MVSIQDIKTATIQPDSLGRFGRFGGKYVPETLMPALSELEAAFQKYRNEPSFQAELQNLL
RDYVGRPSPLYFAERLTANYARPDGTGPQIYLKREDLNHTGAHKINNALAQVLLAKRMGK
QRVIAETGAGQHGVATATVCARFGLRCVIYMGIHDMERQALNVFRMKLMGAEVHPVEAGT
GTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVRDFHAIIGIETRAQSQEKWEGL
PDILLACVGGGSNAIGLFYEFLNEPSIRLIGVEAAGEGVNTEKHAATLTKGKIGVLHGAM
SYLLQDDDGQIIEAHSISAGLDYPGVGPEHSYLKDLGRAEYYSVTDKQALEAFQRLSQLE
GIIPALETAHAIAYLETLCPELEGSPRIVINCSGRGDKDVQTVAKVLIP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggtaagcatacaagacatcaagactgcaactatccaaccagattctttaggcagattt
ggaagatttggtggtaaatacgtccccgaaactttaatgcctgcattaagtgagttagaa
gcagcatttcaaaaatatcgcaacgagccgagtttccaagcagaactgcaaaacctactg
cgcgattacgtcggacgacccagcccattatattttgctgaacgcttgacagcaaactac
gctagaccagatggcactgggccgcaaatctatttaaagcgtgaggatttaaatcataca
ggcgctcacaaaattaataatgctttagctcaggtgttactcgctaaacgtatgggtaag
caaagggttattgccgagacaggtgcaggacaacatggcgtagcaactgcaactgtctgt
gcgcggtttggtttgagatgtgtgatttacatgggcatccacgatatggaacgccaagcc
ctgaatgtcttccgcatgaaattaatgggggcagaagttcatccagtggaggcaggtacg
ggaactctcaaagatgcaacttccgaagcaattcgagattgggtgacaaatgtggaaaca
acccattacatcttgggttctgtcgccgggcctcatccttacccaatgattgtccgtgac
ttccacgcgataattggtattgaaactcgcgctcaatcccaggagaaatgggaaggatta
ccagatattctactggcttgcgtgggtggaggttccaatgcgatcggcttgttctatgaa
tttctcaatgaaccttcaatacgtctaattggagtcgaagcggcgggtgaaggtgtaaat
acagaaaaacacgcagctaccttgacaaaaggaaaaataggtgtattgcatggtgcaatg
agctatttactgcaagatgatgacggtcaaattatcgaagctcattcaattagtgccgga
ttagattatcccggtgttggcccagaacatagttatttaaaggatcttggtcgcgccgag
tattacagtgtgactgataaacaagcgttagaagcatttcaacgactttcgcaactagaa
ggaattatcccagctttggaaactgctcatgcgatcgcatatctcgaaaccctttgccct
gagttagaaggcagtccccgcattgtcatcaattgttccggcagaggtgacaaagatgtg
caaaccgtcgccaaagtcctgattccttaa

DBGET integrated database retrieval system