KEGG   Nitratifractor salsuginis: Nitsa_0008Help
Entry
Nitsa_0008        CDS       T01405                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nsa  Nitratifractor salsuginis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nitsa_0008
Enzymes [BR:nsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Nitsa_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9536..10117)
Genome map
AA seq 193 aa AA seqDB search
MSDKSKKIEAAVRTILENLGEDPDREGLLKTPHRVAKALEFLTEGYHKDPEEILKKALFT
SSNDEMVLVRDIEFYSLCEHHMLPIIGRAHVAYIPDGKVVGLSKIPRVVNLFARRLQIQE
QLTEQIADAISDTIHPKGVAVVIHARHMCMEMRGVEKINSTTVTSALRGLFKKDIRTRNE
FYDLINANVPSNF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaagagcaagaagatcgaagcggccgttcggaccattctggagaacctgggt
gaagatcccgatcgtgaggggctgctcaaaaccccccaccgggtggcaaaggctctggaa
ttcctcaccgagggataccacaaagaccccgaagagattttgaaaaaggccctcttcacc
agcagcaacgacgagatggtcctggtacgggatatcgaattctactccctgtgtgagcac
catatgctccccatcatcggccgggcccacgtcgcctacatccccgacggcaaagtcgtc
ggcctctccaagatccccagagtggtcaacctcttcgcccggcgcttgcagatccaggag
cagctgactgagcagatcgccgacgccatcagcgacaccatccaccccaaaggggtcgcc
gtggtcatccacgcccgccatatgtgtatggagatgcgcggcgtcgaaaagatcaactcc
accaccgtcacctccgccctcagaggcctcttcaaaaaagacatccgtacccgcaacgaa
ttctacgacctcatcaacgccaacgtcccttcgaatttctga

DBGET integrated database retrieval system