KEGG   Nasonia vitripennis (jewel wasp): 100114064Help
Entry
100114064         CDS       T01081                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100114064
   00051 Fructose and mannose metabolism
    100114064
   00562 Inositol phosphate metabolism
    100114064
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100114064
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100114064
  Exosomal proteins of bladder cancer cells
   100114064
  Exosomal proteins of melanoma cells
   100114064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 247 aa AA seqDB search
MARKFVVGGNWKMNGTKKEIDDIVAFLKAGPLDPNVEVVVGVPSIYLTYTKGILPSNVSI
SAQNCYKVPKGAFTGEISPAMLVDNGIPWVIIGHSERRNVFGESDELIAEKVAHALEAGL
KVIACIGEKLEEREAGKTEEVVYRQTKAIADKIKSWDNVVVAYEPVWAIGTGKTATPQQA
QEVHEKLRSWFAKNISPAVAESIRIQYGGSVTADNAKELAKEKDIDGFLVGGASLKPDFV
KIVNAKQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaatttgtagttggtggcaactggaagatgaacggcacgaaaaaagaaatt
gacgatatcgtcgcgttcttgaaagccggcccccttgatccaaatgttgaggtagttgtt
ggagttccctcaatttacctgacatacacaaaaggcattctgcccagcaacgtaagcatt
agtgctcagaactgttacaaagttccaaagggagcatttactggagaaatcagtcctgcc
atgcttgttgataatggcattccgtgggttattattggtcactcagaaagaagaaatgtt
tttggagaatcagatgaactgattgctgaaaaagtggctcatgccttggaagctggttta
aaagtcattgcttgtattggagaaaaattagaagagcgtgaggctggaaagacagaagaa
gttgtctacaggcaaacaaaagctattgcagacaaaattaaatcttgggacaatgttgtt
gttgcatacgagcctgtttgggctattggaaccggtaaaactgctactcctcagcaagca
caagaagtccatgaaaaacttcgctcttggtttgccaaaaatattagtccagcagttgcc
gaatccattagaattcaatatggaggttcagtcacagcagataatgccaaggaattggcc
aaggaaaaagatattgatggcttccttgtaggaggtgcttctctgaaacctgactttgta
aagattgttaatgctaaacagtga

DBGET integrated database retrieval system