KEGG   Nasonia vitripennis (jewel wasp): 100114064Help
Entry
100114064         CDS       T01081                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100114064
   01230 Biosynthesis of amino acids
    100114064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100114064
   00051 Fructose and mannose metabolism
    100114064
   00562 Inositol phosphate metabolism
    100114064
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100114064
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100114064
  Exosomal proteins of bladder cancer cells
   100114064
  Exosomal proteins of melanoma cells
   100114064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
1
AA seq 293 aa AA seqDB search
MRLSFIRVGSEVAKTTFPPCSSLQKYRTVASIRLSILARHQSTPAKMARKFVVGGNWKMN
GTKKEIDDIVAFLKAGPLDPNVEVVVGVPSIYLTYTKGILPSNVSISAQNCYKVPKGAFT
GEISPAMLVDNGIPWVIIGHSERRNVFGESDELIAEKVAHALEAGLKVIACIGEKLEERE
AGKTEEVVYRQTKAIADKIKSWDNVVVAYEPVWAIGTGKTATPQQAQEVHEKLRSWFAKN
ISPAVAESIRIQYGGSVTADNAKELAKEKDIDGFLVGGASLKPDFVKIVNAKQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagacttagttttattcgagttggatctgaagttgcgaaaacaacatttccaccttgc
agtagtttgcaaaaatatcgcacagtagcatctattcgtttatcaatactcgcaaggcac
cagtcaacccctgcaaaaatggcacgcaaatttgtagttggtggcaactggaagatgaac
ggcacgaaaaaagaaattgacgatatcgtcgcgttcttgaaagccggcccccttgatcca
aatgttgaggtagttgttggagttccctcaatttacctgacatacacaaaaggcattctg
cccagcaacgtaagcattagtgctcagaactgttacaaagttccaaagggagcatttact
ggagaaatcagtcctgccatgcttgttgataatggcattccgtgggttattattggtcac
tcagaaagaagaaatgtttttggagaatcagatgaactgattgctgaaaaagtggctcat
gccttggaagctggtttaaaagtcattgcttgtattggagaaaaattagaagagcgtgag
gctggaaagacagaagaagttgtctacaggcaaacaaaagctattgcagacaaaattaaa
tcttgggacaatgttgttgttgcatacgagcctgtttgggctattggaaccggtaaaact
gctactcctcagcaagcacaagaagtccatgaaaaacttcgctcttggtttgccaaaaat
attagtccagcagttgccgaatccattagaattcaatatggaggttcagtcacagcagat
aatgccaaggaattggccaaggaaaaagatattgatggcttccttgtaggaggtgcttct
ctgaaacctgactttgtaaagattgttaatgctaaacagtga

DBGET integrated database retrieval system