KEGG   Nasonia vitripennis (jewel wasp): 100121916Help
Entry
100121916         CDS       T01081                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04013  MAPK signaling pathway - fly
nvi04068  FoxO signaling pathway
nvi04137  Mitophagy - animal
nvi04140  Autophagy - animal
nvi04141  Protein processing in endoplasmic reticulum
nvi04214  Apoptosis - fly
nvi04215  Apoptosis - multiple species
nvi04310  Wnt signaling pathway
nvi04391  Hippo signaling pathway - fly
nvi04624  Toll and Imd signaling pathway
nvi04933  AGE-RAGE signaling pathway in diabetic complications
Module
nvi_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100121916
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100121916
   04310 Wnt signaling pathway
    100121916
   04391 Hippo signaling pathway -fly
    100121916
   04068 FoxO signaling pathway
    100121916
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100121916
   04137 Mitophagy - animal
    100121916
  Cell growth and death
   04214 Apoptosis - fly
    100121916
   04215 Apoptosis - multiple species
    100121916
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    100121916
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100121916
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100121916
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100121916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 100121916
NCBI-ProteinID: XP_008212489
NASONIABASE: NV11643
Position
2
AA seq 390 aa AA seqDB search
MPYLGPDMSTTRLSTMFYTVEVGDTKFTILKRYTNLKPIGSGAQGIVCAAFDTVTQQNVA
IKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRCLDEFQDVYLVMELMDA
NLCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA
RTAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQ
WNKIIEQLGTPAQEFMQRLQPTVRNYVENRPRYPGYPFERLFPDVLFPSDSSEHNRLKAS
QARDLLSRMLVIDPERRISVDDALLHNYINVWYDEGEVNAPAPGPYDHSVDEREHTVDQW
KELIYQEVMEYETSHNTASASQSPDTAGSR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccttacctcgggcctgacatgtcgactacccgactatccaccatgttctacacggtc
gaggtcggggacaccaagttcaccatcctcaagagatacaccaacctcaagcccatcggc
tcgggggcccagggtatcgtttgcgcggcgttcgacacagtgactcagcagaatgtggcc
atcaagaagctctcgaggccctttcagaacgtcacgcacgccaagagggcatatcgggag
ttcaagctcatgaagctcgtcaaccacaaaaacataatcggactgctgaacgccttcacg
ccgcagaggtgcttggacgagtttcaggacgtctatctggtgatggagctcatggacgcg
aacctctgccaagtcatccagatggacctggaccacgagcgcatgtcctacctgctctac
cagatgctctgcggcatcaagcatttgcattccgccgggatcatacacagggatttgaag
cctagcaatattgtcgtcaagtcagactgcaccctcaagatattggacttcggcctcgcg
aggacggctggcacgaccttcatgatgacgccctacgtcgtgacgaggtactacagggcg
cccgaggtcatcctcggcatgggatacaaggaaaatgtcgacatctggtccgttggctgc
atcatgggtgagatgattcgcggtggtgtcctcttccccggcaccgatcacatcgatcag
tggaacaaaattatagagcaattgggaactccggcgcaagagttcatgcagcgactacag
cccaccgtgaggaactacgtggagaaccggccacgctatcccggctaccccttcgagagg
ctatttccggacgtcctctttccctcggactcctcggagcacaatcgtttgaaagcgagc
caggccagggatctattgtcgcgaatgttggtcatcgatccggaacggcgcatctccgtc
gatgacgccctgcttcataattacataaatgtttggtacgacgagggtgaagtgaacgcc
cccgccccgggtccgtacgatcacagcgtcgacgagagagagcataccgtcgaccagtgg
aaggaactcatctaccaagaggtcatggaatacgagaccagccacaacactgcgtccgct
tcgcaatcgccagatacggcgggctcccggtag

DBGET integrated database retrieval system