KEGG   Nasonia vitripennis (jewel wasp): 100123875Help
Entry
100123875         CDS       T01081                                 

Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NASONIABASE: 
UniProt: 
Position
2
AA seq 482 aa AA seqDB search
MDVDKISVFTAVGFALAVGAFVLWGPSPRPRRKGQVVGIKNLGYTCFLNSLLQSLAACPA
FIEWLRRRQEDVKGESFTSSLMLVIDKINGFTDDMFGSVRPVEVITSLGPLWNFAPGHQD
AHELFHVFLSALQAELQTACRKGCLSDALPKAPLVITDIKGSGDPVNLRSVSCNDIASAN
ERCEVPRETNKNLSNHVVTYAQSITNVSASMTSIKPGIILARSSEIISKIIGESGDDGDS
LRPWSSMCAIPSQNTTPSFSNKVHPFSGLLTSQLICTACEWKSPVHFDKLESVSLPLPPV
TDGFMWKRLTLVDLLSRLVSKEVINDVQCDGCNNRCAAYKTLTFGKLPKCLCLHIPRTTW
SSSGKPIKRDDPVIFNEALILDPFTYTDTKRKNTQSQGSLHSMALLNGQSLQRGKHKYYL
YAVIEHRGPVDAGHFVCYRRGNRPGQWLYTSDTIVQKTTLEDVLSASPYLLFYERAVTRD
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgataagatctctgtcttcactgctgtgggctttgcactggctgttggagcc
ttcgtactctggggcccttcacctaggccaaggagaaaaggccaagtcgttggaattaaa
aatttagggtatacttgcttcctgaactcgttgctgcagtccttagcagcatgtccagca
ttcatagagtggcttcgaagaaggcaggaggatgtgaagggagaatcttttacaagcagt
ttgatgttggtcatagacaaaatcaatgggtttacggatgatatgtttggaagcgtgagg
ccagttgaagtaattacttctctgggtcctctctggaattttgctccagggcatcaagat
gctcacgaattatttcacgtttttctgagtgctcttcaagctgaactgcagactgcatgc
agaaagggttgcttgtctgatgctttgccaaaagctccattagtgataactgatataaaa
ggatccggagatcctgtgaatttgagaagtgtgtcttgcaatgacattgcatcagctaat
gaaagatgcgaagttccaagggaaacaaataaaaatctcagcaatcatgtggtgacttat
gcacagtctataacaaacgtatcagcttccatgacatctatcaaacctggtatcattctt
gcgagatcttctgaaataatttcaaaaataattggagaaagtggtgatgatggagattct
ctgaggccatggagttcaatgtgtgccattccttcacaaaacactactccttcgttttcc
aataaagtccatccattttctggcttgttgacaagtcaattgatatgcacagcatgtgaa
tggaagagtccagtacatttcgataaattagaaagtgtttcattacctctaccaccagtt
actgatgggtttatgtggaagagacttactctggtggatttactttctcgactggtatcg
aaggaagtcattaatgacgtgcaatgtgatggttgcaataatcgatgtgcagcttacaaa
actcttacattcggcaaactaccgaagtgcctgtgtctccacattccaagaacaacatgg
agctcttctggaaagccaataaaaagagatgatcctgtgatattcaatgaggctcttata
ctagatccttttacatacacagacaccaagagaaagaatacgcaatcacaaggtagtttg
cattcaatggcgcttctaaatggtcaatcgctgcagcgcggcaaacataagtattatctt
tatgccgttattgagcaccgaggacccgtcgatgctggtcattttgtctgttacagacgg
ggtaatcgtccaggccaatggttgtacacttctgacacaatagtgcaaaaaacgactcta
gaggatgtcctaagtgctagtccgtacctattgttttacgaaagagcagtcacacgcgat
caacaataa

DBGET integrated database retrieval system