KEGG   Ornithorhynchus anatinus (platypus): 100077046Help
Entry
100077046         CDS       T01045                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100077046 (FLNA)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100077046 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100077046 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    100077046 (FLNA)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100077046 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2656 aa AA seqDB search
MSSSHSRHNQSGAAVAGGGGGGGGGGGVGGGGDKEAEMPATEKDLAEDAPWKKIQQNTFT
RWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMYRKYNQRPTFRQMQLENVSVA
LEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEETKKQTPKQ
RLLGWIQNKLPQLPITNFSKDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQ
QADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPG
IEPSGNMVKKRAEFTVETISAGQGEVLVYVEDPAGHREEAKVIANNDKNRTFSVWYIPKV
TGTHKVTVLFAGQHIAKSPFEVNVDKSHGDASKVTAQGPGLEPSGNIANKTTYFEIFTAG
AGVGEVEVVIQDPTGKKGTVEQQLEDKGNSTYRCTYKPTLEGTYTIYITFAGVPIPRSPY
TVTIGQACNPNACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVVVKGPKGEERVKQ
KDLGDGVYAFEYYPTAPGNYIVTITWGGQNISRSPFEVKVGTECGNQKVRAWGPGLEGGV
VGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCN
NEDIKLSPFMAEIKTAPKDFYPEKVKARGPGLEKTGVAINKPAEFTVDAKNGGKAPLKVQ
VQDSEGSPVEVSVKDNGNGTYNCSYVPKKPVKHTAMVSWGGVNIPNSPYRVNVGAGSHPN
KVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRND
NDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRIKVDPSHDASKVKAEGPGLNRSGVELG
KPTHFNVNAKPAGKAKLDVQFTGPAKGDAVQDVDVIDHHDNTYTVKYTPVQQGNMGVNVT
YGGDHIPKSPFSVGVAQTLDLNKIKVSGLGEKVEVGKDQEFTVKSKGAGGQGKVGAKIIG
PSNKSVPCKVEPGLSADNSVVKFIPREEGPYEVEVTYDGVPVPGSPFPVEAVPPTNPSKV
KAYGPGLKGGSAGSPAPFTIDTKGAGNGGLGLTVEGPCEAKIECLDNGDGTCSVSYLPTE
PGEYSINILFADSHIPGSPFKAQIAPCFDPSKVKCSGPGLEHATVGEAGQFHVDCSSAGS
AELTIEIISDTGMQAEVRIQDNGDGTYTITYIPLYPGVYTITIKYGGQMVPDFPSKLKVE
PAVNTAGVKCYGPGVEGKGVFREATTEFNVDARALTKAGGPHIKTRVSNPSGNLTDTYVQ
DNGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFHVPVTEGCDPARVRVHGPGIQSGTT
NKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYSLNVTYGG
HQVPGSPFKVPVHDVIDSSKVKCSGPGLSPGVVRANVPQSFQVDTSKAGVAPLQVKVQGP
KGVVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKA
SGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTTIRDNQDGTYTVSYVP
DMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEET
VITVDAKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEH
IPNSPFQVMALDGDQPAAQQMMPQQLAPPYPYPPGMQQPWATDRPLMGVNGLDVAGLRPF
DLVIPFTIKKGEITGEVRMPSGKVAKPDITDNKDGTVTVRYAPTEAGLHEMDIRYDNMHI
PGSPLQFYVDYVNSGHVTAYGPGLIHGVVNKPAVFTVNTKDAGEGGLSLAIEGPSKADIG
CTDNQDGTCTVSYLPVLPGDYNILVKYNDKHIPGSPFTAKITGDDSIRMSHLKVGSAADI
PLNITETDISQLTATVIPPSGREEPCLLKRLRNGHVGISFVPKEIGEHIVNIKKNGHHIP
NSPITVTISQSEIGDASRVRVSGPGLSEGRTFEPAEFIIDTRDAGYGGLSLSIEGPSKVD
INTEDLEDGTCKVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESISRKQRAP
SVANVGSHCDLSLKIPEINIRDMTAQVTSPSGKTHEAEIMEGENNTYCIRFVPTEMGVHT
VNVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGL
SIAVEGPSKAEIAFEDRKDGSCGVSYIVQEPGDYEVSVKFNDDHIPDSPFVVPVASPSDD
ARRLTVSSLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECYVTEIDQDKYAVR
FIPRENGIYLIDVKFNGSHIPGSPFKIRVGEPGQGGDPGMVSAYGAGLEGGITGSPAEFI
VNTTGAGAGALSVTIDGPSKVKMDCQECSEGYKVTYTPMAPGSYLISIKYGGPYHIVGSP
FKAKVTGPRLVSSHSLHETSSVFVDSVTKADAVLQQGAPPKFHSDASKVVAKGLGLNKAF
VGQKNSFTVDCSKAGNNMLLVGVHGPKTPCEEILVKHLGNRLYNVTYLLKDKGDYTLVVK
WGEDHIPGSPFHLTVP
NT seq 7971 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctcccactccaggcacaaccagagcggtgctgcggtcgcaggaggaggaggt
ggaggtggaggaggaggtggggtcggaggagggggcgacaaggaggccgagatgccagcc
accgagaaggacctggccgaagacgcgccctggaaaaagatccagcagaacaccttcacc
cgctggtgcaacgagcacctgaaatgcgtcaacaaacgcatcgccaacctgcagaccgac
ctgagcgatgggctgcggctgatcgcgctgctggaggtgttgagccagaagaagatgtac
cgcaagtacaaccagcgccccactttccgccagatgcagctggagaacgtgtccgtggcc
ctcgagttcctggaccgggagagcatcaagctcgtgtccatcgacagcaaagccatcgtg
gatgggaacctgaagctgatcctggggctgatatggacgctgatcctgcactactccatc
tccatgcccatgtgggacgaggaggaggacgaggagaccaagaagcagacccccaagcag
cgactcttgggttggattcaaaacaagcttccccagctgcccatcaccaacttcagcaaa
gactggcagagcggcagggccctgggcgccctcgtggacagctgtgcccctggtctgtgc
ccggactgggattcctgggatgccagcaagcctgtgaacaatgctcgggaagccatgcag
caggcggatgattggctgggaatacctcaggtgatcactccagaggagattgtggacccg
aacgtggatgagcactctgtcatgacctacctatcgcagttccccaaggccaagctgaag
ccgggggcccctctccgccccaagctgaaccccaagaaggccagagcctatgggccaggc
attgagcccagtggcaacatggtgaagaaacgggccgagttcactgtggagaccatcagc
gccggccagggcgaggtgctggtgtatgtggaagaccctgccggacaccgggaggaggct
aaagtgattgccaacaatgacaagaatcgcactttctctgtgtggtatatccccaaagtg
accggaacccacaaggtgaccgtgctcttcgccggccagcacattgccaagagccccttc
gaggtgaacgtggacaagtcccacggtgacgccagcaaggtcacggcccagggacccggc
ctggagccgagcggcaatatcgccaataagaccacctactttgagatcttcaccgctggt
gccggtgtgggcgaggtggaagtggtcatccaggacccgacggggaagaagggcactgtg
gagcagcagctggaagacaagggcaacagcacctaccgctgtacctacaagcccaccctg
gagggcacctacaccatctacatcaccttcgctggggtgcccatccctcggagcccctac
accgtcaccattgggcaagcctgtaaccccaatgcctgccgcgcggtgggccgggggctg
caacccaagggtgtccgcgtgaaggagactgctgacttcaaggtgtacaccaagggagca
ggaagtggtgaactgaaggtcgtggtcaagggaccgaagggagaagagcgtgtgaaacag
aaggatctgggagatggagtatatgcgtttgagtactaccccaccgcgcctggaaattat
atcgtgacaatcacgtggggaggtcagaacatctccagaagccccttcgaggtgaaagtg
ggcacagagtgtgggaaccagaaggtgcgagcatggggtcccggcctggaaggaggtgtg
gtcggcaagtccgctgactttgtggtggaagccatcggggatgacgttggcacacttggt
ttctccgtggagggcccatcgcaggccaagatcgagtgtgatgacaagggagatggctca
tgcgacgtgcgatactggccgcaggaggcaggcgagtatgccgtccacgtcctctgcaac
aacgaggacatcaagctcagccccttcatggcggagatcaagaccgcaccaaaggacttc
tacccggagaaggtgaaggcccgaggtcctggtttggagaagacaggtgtggccatcaac
aaacctgctgagttcaccgtcgatgccaagaatggtggaaaggccccactcaaagtccaa
gtgcaggacagcgagggctctcctgtcgaagtctccgtgaaggacaatggcaacggcacc
tacaactgctcttacgtccccaaaaagccagtgaagcacacggccatggtgtcctggggg
ggagtcaacatccccaacagcccctaccgggtcaacgtaggagctggtagccaccccaat
aaagtgaaggtctatggaccaggagtggccaagactggcctcaaggcccacgaacctacc
tactttactgtggactgcacagaggctggccagggcgatgtgagcatcggcatcaagtgt
gccccgggagtcgtggggccggctgaggcagatatcgactttgacatcatccgcaacgac
aacgacaccttcacggtcaagtacaccccccgtggggccggcagctacaccatcatggtg
ctgttcgctgaccaggctacacccaccagccctatccgcatcaaggtggacccctcccac
gatgccagcaaggtcaaggccgagggacctgggctcaacaggagtggcgtggagctgggc
aaacccactcacttcaatgttaatgccaagcctgcgggcaaggccaagctggacgtccag
ttcaccggtcctgccaagggggatgccgtgcaggacgtggatgtcatcgatcaccacgac
aacacgtacaccgtcaagtatacgccggtgcagcagggcaacatgggagtgaatgtgacc
tacggaggagaccacattcccaagagccctttctccgtgggtgtcgcccagaccctggac
ctcaacaagatcaaagtttctggccttggcgagaaagttgaagtcggcaaagaccaggag
ttcacagtcaagtccaaaggcgccgggggccagggcaaggtgggcgccaagatcatcggc
ccctccaacaaatccgtgccctgcaaggtggagccgggcctgagcgcggacaacagtgtc
gtcaagttcattccccgggaggaaggaccctatgaggtggaagtgacctacgacggtgtg
cctgtgccgggcagccccttccccgtggaggccgtacccccaaccaacccatctaaggtg
aaggcctatggcccgggtctcaagggcggctctgccggctcccccgcccccttcaccatc
gacaccaagggggctggcaacggaggcctgggcctgactgtggagggcccctgcgaggcc
aagattgagtgcctggacaatggcgatggcacctgctccgtgtcctacctgcccacggag
ccgggcgagtacagcatcaacatcctgtttgccgacagccacatccctggctcgcccttc
aaggcccagatcgccccctgtttcgacccctccaaggtcaaatgctctgggcctgggctg
gagcacgccacagtcggggaagccggccagttccacgtggactgctccagcgccggaagt
gccgagctgaccatcgagatcatctcggacaccggcatgcaggccgaggtgcgcatccag
gacaacggggacggcacctataccatcacctacatccccctctatccgggcgtctacacc
atcaccatcaagtacggtggccagatggtgccagacttccccagcaagctgaaggtggag
ccagccgtcaacaccgccggcgtcaagtgctacggtcctggtgtggagggcaaaggtgtc
ttccgggaggctaccaccgaattcaatgtggatgcccgagccctgaccaaggctggaggc
ccccacatcaagacccgggtgtccaatccgtcaggcaatctgaccgacacctatgtgcag
gacaatggggatggcacatacaaagtggagtacacgccatatgaggaaggtgtccactct
gtggatgtgacttatgacggcagcccggtgcccagcagcccattccacgtccctgtgact
gaagggtgtgaccccgccagggtccgggtccacgggcctggcattcagagtggcactacc
aacaaacccaacaagttcactgtggagaccaggggagcaggcactgggggtctcggtttg
gctgtggaaggcccttcagaagccaagatgtcctgcacagacaataaggacggcagttgc
tctgtggaatacattccttatgagcctggcacctacagcctcaatgtcacctatgggggc
caccaagttccaggcagcccattcaaggtgccggtgcatgatgtaatagactcatccaag
gtgaagtgctcagggcctggactcagccctggggtggttagagccaacgtcccacagtcc
ttccaagtggataccagcaaggctggggtggcaccactccaggtcaaagttcaaggcccc
aaaggggtggtggagccggtggacgtggtggacaatgccgatgggactcagacggtcaac
tacgtgccaagccgagaaggtccttacagcatctctgtgctttacggggatgaagaggtg
ccacgcagtcccttcaaggtgaaggtcctgcccactcatgatgccagtaaagtgaaggcc
agcggtcccggactcaacaccaccggcgtgccagccagcctcccggtggagtttaccatt
gatgccaaggatgctggcgaaggccttctggctgtccaaatcacggaccccgaagggaag
cccaaaaagacaaccatccgggacaaccaggacggcacctacacggtgtcctacgtgccg
gacatgactggccgctacaccatcttgatcaagtacggtggagatgagatcccgtactct
ccctaccgcatccgggccctgcccaccggcgatgccagcaagtgcacagtcacagtgtca
attggaggtcacgggctaggcgccggcatcggccccaccatccagatcggcgaggagacg
gtgatcacggtggatgccaaggccgcgggcaagggcaaggtgacttgcacggtctgcacc
ccggatggctcggaggtggacgtggacgtggtggagaacgaggacggcaccttcgacatc
ttctacacggccccccagcccggcaaatacgttatctgtgtgcgctttggtggcgagcac
atccccaacagccccttccaagtcatggcgctggatggtgatcagccggccgctcagcag
atgatgccacagcagctagccccaccctatccatacccgccgggcatgcagcaaccctgg
gcaaccgaccgcccgctgatgggagtgaacggattggatgtggctggcctgcgacctttt
gacctggtcatccccttcaccatcaagaagggagagattacaggtgaagtccgtatgcca
tctgggaaggttgccaagccggacatcacggacaacaaggacgggaccgtgacggtgagg
tacgccccaacggaagccgggctgcatgagatggacatccgctacgacaacatgcacatt
ccaggaagccccttgcagttctacgtggattacgtcaacagcggccacgtgacagcctat
ggacctggactgatccacggggtggtcaacaagccggctgtcttcaccgtcaacacgaag
gatgctggcgagggcggcctgtccctggccatcgagggtccttccaaggctgacatcggc
tgtaccgacaaccaggatggcacctgcacggtctcctacctccccgtcctgcctggcgac
tacaacatcctggtcaaatacaacgataaacacatccccggcagccccttcacagctaaa
atcacaggggacgactcgatacgcatgtcccacttgaaagtgggctctgccgcggacatc
cccctcaacatcaccgagacggacatcagccagctgacagccacagtcatcccgccctca
ggccgcgaagagccctgcctactcaagaggctgcgcaacggccatgttggtatctccttc
gtccccaaggagatcggcgagcacatagtgaacatcaagaagaacggccatcacatcccc
aacagccccatcaccgtgaccatcagccagtcggagatcggggatgccagccgggtgcgg
gtctcgggcccgggcctgagcgagggccgaacctttgagcctgcagagttcatcatcgac
acccgggatgcgggctatggtggcctcagtctctccatcgagggccccagcaaggtggac
atcaacaccgaagacctagaagatggcacctgcaaagtcacctactgtcccacagagcct
ggcaactacatcatcaacatcaagtttgctgaccagcacgtgccaggcagcccattctcc
gtaaaggtgacaggagaaggccgggtcaaggagagcatctcccgaaaacagcgtgccccc
tcagtggccaatgttggcagccattgcgacctcagcctgaagatcccagaaatcaacatc
cgggacatgacggcccaggtgaccagtccttcgggcaagacccacgaagccgagatcatg
gaaggcgaaaacaacacctactgcatccgcttcgtgcccacggagatgggcgtccacacg
gtcaatgtcaagtacaagggccagcatgtccccggaagccccttccagttcaccgtgggg
cccttgggagaaggcggggcccacaaggtgcgggccggaggccccggcctcgagcgagca
gaagccggagtgccagcggagttcagcatttggacccgagaggctggtgctgggggcctg
tccattgccgtggagggtcccagcaaggctgagatcgctttcgaggaccggaaggatggt
tcatgtggtgtgtcctacatcgttcaagagcctggtgactacgaggtctcggtgaagttc
aatgatgaccacatccccgacagccccttcgtggtgcccgtggcctcaccttcggacgac
gctcgccgcctcactgtttctagtcttcaggagtcagggttaaaggtcaaccagccagcc
tcttttgcagtcagcctcaacggggccaagggcgtcattgatgccaaagtgcacagcccg
tcaggggccctggaggaatgctacgtcactgagatagaccaagacaaatacgccgtgcgc
ttcattccccgcgagaatggcatctacctgatcgacgtcaagttcaacggctcccacatc
cccggcagccctttcaagatccgcgtcggggaacccgggcaaggcggggacccgggcatg
gtctccgcctatggggctggcttggaagggggcatcacagggagcccggccgagttcatc
gtgaacaccaccggcgcaggcgcgggagctctgtccgtcaccatcgacggcccctccaag
gtgaagatggactgccaggagtgctctgagggctacaaggtcacctacacgcccatggcg
cctggcagctacctgatttccatcaaatacgggggtccctatcacattgtgggcagtccc
ttcaaggccaaggtcacaggtccccgcctggtgagcagtcacagcctccacgagacctct
tctgtttttgtggactcggtgaccaaggcggatgcggttctgcagcagggagccccgccc
aagttccactcggatgccagcaaagtggtggccaagggactggggctcaacaaggccttt
gtgggccagaagaactcattcaccgtcgactgcagcaaagcaggaaacaacatgctcttg
gtcggggtccatgggccgaagaccccgtgtgaggagatcctggtgaaacacctaggcaac
cggctctacaacgtcacctacctgctgaaggacaagggcgactacaccttggtggtcaag
tggggggaagaccacatccccgggagtcccttccacctgactgtcccttaa

DBGET integrated database retrieval system